11 products were found matching "GeneID 165545"!

No results were found for the filter!
Anti-DQX1
Anti-DQX1

Item number: ATA-HPA039158.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 76% and to rat: 76%
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1
Application: ICC, IHC
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-DQX1
Anti-DQX1

Item number: CSB-PA002190.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, ATP dependent RNA helicase DQX1...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse, monkey
From 126.00€ *
Review
Anti-DQX1
Anti-DQX1

Item number: CSB-PA906253.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, ATP dependent RNA helicase DQX1...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
284.00€ *
Review
Anti-DQX1
Anti-DQX1

Item number: ATA-HPA046763.100

Polyclonal Antibody against Human DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Validated applications: ICC, Uniprot ID: Q8TE96, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-DQX1
Anti-DQX1

Item number: ATA-HPA046763.25

Polyclonal Antibody against Human DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Validated applications: ICC, Uniprot ID: Q8TE96, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 85% Rat gene identity: 85%
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
DQX1 PrEST Antigen
DQX1 PrEST Antigen

Item number: ATA-APrEST79101.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: DQX1, EC=3.6.4.12, DEAQ box polypeptide 1, ATP-dependent RNA helicase DQX1
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-DQX1
Anti-DQX1

Item number: ABD-8C14660.50

Custom conjugation services for this antibody as available (eg. labeling of Anti-DQX1 with HRP. Available labels are AF: AF350, AF488, AF555, AF594, AF647, AF680, AF700, AF750. Proteins: HRP, Alkaline Phosphatase, Streptavidin. Tandems: APC, APC/Cy7, APC/AF750, APC/iFluor(TM) 700, APC/iFluor(TM) 750, PE, PE/Cy5,...
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, DQX1 Antibody
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, mouse
628.00€ *
Review
Anti-DQX1
Anti-DQX1

Item number: ELK-ES2197.100

similarity:Contains 1 helicase ATP-binding domain.,similarity:Contains 1 helicase C-terminal domain., Recommended dilutions: Western Blot: 1/500 - 1/2000. ELISA: 1/20000. Not yet tested in other applications.. Cellular localization: Nucleus .
Keywords: Anti-DQX1, EC=3.6.4.12, Anti-DEAQ box polypeptide 1, Anti-ATP-dependent RNA helicase DQX1, DQX1 rabbit pAb
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, mouse, monkey
From 173.00€ *
Review
DQX1 (human), recombinant protein
DQX1 (human), recombinant protein

Item number: ABS-PP-12215.100

Keywords: ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, Recombinant Human DQX1 Protein
Expressed in: E.coli
Origin: human
MW: 26.5 kD
From 90.00€ *
Review
DQX1 PrEST Antigen
DQX1 PrEST Antigen

Item number: ATA-APrEST96116.100

PrEST Antigen DQX1, Gene description: DEAQ-box RNA dependent ATPase 1, Alternative Gene Names: FLJ23757, Antigen sequence: VSGYFLKVARDTDGTGNYLLLTHKHVAQLSSYCCYRSRRAPARPPPWVLYHNFTISKDNCLSIVSEIQPQMLVEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 85% Rat gene identity:...
Keywords: DQX1, EC=3.6.4.12, DEAQ box polypeptide 1, ATP-dependent RNA helicase DQX1
Expressed in: E.coli
Origin: human
264.00€ *
Review
DQX1 (human), recombinant protein
DQX1 (human), recombinant protein

Item number: ABS-PP-12215-L.100

Keywords: ATP-dependent RNA helicase DQX1, DEAQ box polypeptide 1, Recombinant Human DQX1 Protein
Expressed in: E.coli
Origin: human
MW: 26.5 kD
From 115.00€ *
Review