- Search results for GeneID 159163
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
12 products were found matching "GeneID 159163"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA053147.100
Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity...
| Keywords: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: CSB-EP614891HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-496aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MVEADHPGKL FIGGLNRETN EKMLKAVFGK HGPISEVLLI KDRTSKSRGF AFITFENPAD AKNAAKDMNG TSLHGKAIKV EQAKKPSFQS GGRRRPPASS RNRSPSGSLR SARGSSGGTR GWLPSHEGHL...
| Keywords: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 71.7 kD |
From 219.00€
*
Item number: ATA-HPA057723.100
Polyclonal Antibody against Human RBMY1F, Gene description: RNA binding motif protein Y-linked family 1 member F, Alternative Gene Names: MGC33094, Validated applications: ICC, Uniprot ID: Q15415, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: RNA-binding...
| Keywords: | Anti-YRRM2, Anti-RBMY1F, Anti-RBMY1J, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: 375005.1
RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. Source: Recombinant protein corresponding to aa1-496 from human RBMY1F, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~71.7kD, AA...
| Keywords: | YRRM2, RBMY1F, RBMY1J, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| MW: | 71,7 |
From 603.00€
*
Item number: ATA-APrEST89144.100
Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: G-CAB16604.20
Protein function: RNA-binding protein which may be involved in spermatogenesis. Required for sperm development, possibly by participating in pre-mRNA splicing in the testis. [The UniProt Consortium]
| Keywords: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | rat |
149.00€
*
Item number: CSB-CL614891HU.10
Length: 1491 Sequence: atggtagaag cagatcatcc tggcaagctt ttcattggtg gcctcaatag agaaaccaat gagaagatgc ttaaagcagt atttgggaaa catggtccca tatcagaagt tcttttgata aaggatcgaa ccagcaaatc cagaggcttt gcatttatta cttttgagaa ccctgcagat gctaagaatg ctgcgaaaga tatgaatgga acgtctttgc atggaaaagc aataaaagta gaacaagcca agaaaccatc...
| Keywords: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA614891LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Keywords: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA614891LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Keywords: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA614891LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Keywords: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA614891LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: RBMY1F. Antigen Species: Human
| Keywords: | Anti-YRRM2, Anti-RBMY1J, Anti-RBMY1F, Anti-Y chromosome RNA recognition motif 2, Anti-RNA-binding motif protein, Y... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ATA-APrEST95767.100
PrEST Antigen RBMY1F, Gene description: RNA binding motif protein Y-linked family 1 member F, Alternative Gene Names: MGC33094, Antigen sequence: WRNDRMSTRHDGYATNDGNHPSCQETRDYA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: RNA-binding protein which may be involved in...
| Keywords: | YRRM2, RBMY1J, RBMY1F, Y chromosome RNA recognition motif 2, RNA-binding motif protein, Y chromosome, family 1 member F/J |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*