8 products were found matching "GeneID 152405"!

No results were found for the filter!
Anti-C3orf30
Anti-C3orf30

Item number: ATA-HPA062468.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 40% and to rat: 42%
Keywords: Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II...
Application: IHC
Host: Rabbit
Species reactivity: human
From 330.00€ *
Review
Anti-TEX55
Anti-TEX55

Item number: ATA-HPA068480.100

Polyclonal Antibody against Human TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Validated applications: ICC, Uniprot ID: Q96M34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 25% Rat gene identity: 25%
Keywords: Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-TEX55
Anti-TEX55

Item number: ATA-HPA068480.25

Polyclonal Antibody against Human TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Validated applications: ICC, Uniprot ID: Q96M34, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 25% Rat gene identity: 25%
Keywords: Anti-C3orf30, Anti-Testis-specific expressed protein 55, Anti-Testis-specific conserved, cAMP-dependent type II...
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
C3orf30 PrEST Antigen
C3orf30 PrEST Antigen

Item number: ATA-APrEST87967.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
C3orf30 (Vector pUC, Accession No. BC130475)
C3orf30 (Vector pUC, Accession No. BC130475)

Item number: CSB-CL822257HU.10

Length: 1611 Sequence: atggaagagc ctccgcaaga ggctctggct gaacccttga aacatgaaag cccagccgct ccctcaagtg ctggccacac taagggccag gaagaagacg accagaagaa ccaggccgaa aggaaggcag ataaccacac tgctcacaga atagctgacc agactgccct aagagtgcct agccaggctg aatccagcat atttagccaa gctaccaacg gagtagctga acaaaatggg catagtacac ctggtcaggc...
Keywords: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Application: Molecular biology, clone
Species reactivity: human
592.00€ *
Review
TEX55 (human), recombinant protein
TEX55 (human), recombinant protein

Item number: ABS-PP-2645.100

Keywords: Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein, Recombinant...
Expressed in: E.coli
Origin: human
MW: 16 kD
From 90.00€ *
Review
TEX55 PrEST Antigen
TEX55 PrEST Antigen

Item number: ATA-APrEST95700.100

PrEST Antigen TEX55, Gene description: testis expressed 55, Alternative Gene Names: C3orf30, FLJ32859, TSCPA, Antigen sequence: DYRLAGLADPGTSEQTDLRLYGLVDHKTSVKTHHQVYGQATELAEHQAIDQAHSNADQPPVDNAHYTESDQTDHLADRQAN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 25% Rat...
Keywords: C3orf30, Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein
Expressed in: E.coli
Origin: human
264.00€ *
Review
TEX55 (human), recombinant protein
TEX55 (human), recombinant protein

Item number: ABS-PP-2645-L.100

Keywords: Testis-specific expressed protein 55, Testis-specific conserved, cAMP-dependent type II PK-anchoring protein, Recombinant...
Expressed in: E.coli
Origin: human
MW: 16 kD
From 115.00€ *
Review