- Search results for GeneID 1521
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
9 products were found matching "GeneID 1521"!
Close filters
Filter by:
No results were found for the filter!
Item number: TGM-TMPH-03836-100ug
Description: Cathepsin W Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is P56202.
| Keywords: | Cathepsin W , CTSW , Lymphopain |
| MW: | 33.1 kD |
From 122.00€
*
Item number: CSB-EP006205HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 128-376aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: VPFSCDWRKV ASAISPIKDQ KNCNCCWAMA AAGNIETLWR ISFWDFVDVS VQELLDCGRC GDGCHGGFVW DAFITVLNNS GLASEKDYPF QGKVRAHRCH PKKYQKVAWI...
| Keywords: | CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W, Recombinant Human Cathepsin W (CTSW) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 33.1 kD |
From 364.00€
*
Item number: ATA-HPA066903.100
Polyclonal Antibody against Human CTSW, Gene description: cathepsin W, Validated applications: IHC, Uniprot ID: P56202, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity....
| Keywords: | Anti-CTSW, Anti-Lymphopain, Anti-Cathepsin W, EC=3.4.22.- |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-PP-11900-L.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
| Keywords: | Cathepsin W, Lymphopain, Recombinant Human CTSW Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 40.5 kD |
From 115.00€
*
Item number: VHPS-2334
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Application: | RNA quantification |
45.00€
*
Item number: ELK-ES19963.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000 ELISA 1:5000-20000. Cellular localization: Endoplasmic reticulum .
| Keywords: | Anti-cleaved-CTSW, Anti-cleaved-Lymphopain, Anti-cleaved-Cathepsin W, EC=3.4.22.-, CATW (Cleaved-Val128) rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
Item number: CSB-CL006205HU.10
Length: 1131 Sequence: atggcactga ctgcccaccc ctcctgcctc ctggccctgt tggtggcagg cctagcccaa ggcatcagag gcccccttag ggcccaggac ctaggtcccc agccgctaga gctgaaagag gccttcaagt tgttccagat ccagttcaac cggagttacc tgagcccaga agagcatgct caccgcctgg acatctttgc ccacaacctg gcccaggctc agaggctgca ggaggaggac ttgggcacag ctgagtttgg...
| Keywords: | CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
421.00€
*
Item number: ABS-PP-11900.100
Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
| Keywords: | Cathepsin W, Lymphopain, Recombinant Human CTSW Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 40.5 kD |
From 90.00€
*
Item number: ATA-APrEST95971.100
PrEST Antigen CTSW, Gene description: cathepsin W, Antigen sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have a specific function in the mechanism or regulation of T-cell...
| Keywords: | CTSW, Lymphopain, Cathepsin W, EC=3.4.22.- |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*