10 products were found matching "GeneID 1521"!

No results were found for the filter!
Cathepsin W Protein, Human, Recombinant (His & Myc)
Cathepsin W Protein, Human, Recombinant (His & Myc)

Item number: TGM-TMPH-03836-100ug

Description: Cathepsin W Protein, Human, Recombinant (His & Myc) is expressed in E. coli with N-10xHis, C-Myc. The accession number is P56202.
Keywords: Cathepsin W , CTSW , Lymphopain
MW: 33.1 kD
From 122.00€ *
Review
Cathepsin W (CTSW), human, recombinant
Cathepsin W (CTSW), human, recombinant

Item number: CSB-EP006205HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 128-376aa. Protein Length: Full Length. Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged. Target Protein Sequence: VPFSCDWRKV ASAISPIKDQ KNCNCCWAMA AAGNIETLWR ISFWDFVDVS VQELLDCGRC GDGCHGGFVW DAFITVLNNS GLASEKDYPF QGKVRAHRCH PKKYQKVAWI...
Keywords: CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W, Recombinant Human Cathepsin W (CTSW)
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 33.1 kD
From 364.00€ *
Review
Anti-CTSW
Anti-CTSW

Item number: ATA-HPA066903.100

Polyclonal Antibody against Human CTSW, Gene description: cathepsin W, Validated applications: IHC, Uniprot ID: P56202, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity....
Keywords: Anti-CTSW, Anti-Lymphopain, Anti-Cathepsin W, EC=3.4.22.-
Application: IHC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-CTSW
Anti-CTSW

Item number: ATA-HPA066903.25

Polyclonal Antibody against Human CTSW, Gene description: cathepsin W, Validated applications: IHC, Uniprot ID: P56202, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity....
Keywords: Anti-CTSW, Anti-Lymphopain, Anti-Cathepsin W, EC=3.4.22.-
Application: IHC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
CTSW, Human cathepsin W, Real Time PCR Primer Set
CTSW, Human cathepsin W, Real Time PCR Primer Set

Item number: VHPS-2334

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: CTSW, Lymphopain, Cathepsin W, EC=3.4.22.-
Application: RNA quantification
45.00€ *
Review
Anti-cleaved-CATW (Val128)
Anti-cleaved-CATW (Val128)

Item number: ELK-ES19963.100

Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium] Recommended dilutions: WB 1:1000-2000 ELISA 1:5000-20000. Cellular localization: Endoplasmic reticulum .
Keywords: Anti-cleaved-CTSW, Anti-cleaved-Lymphopain, Anti-cleaved-Cathepsin W, EC=3.4.22.-, CATW (Cleaved-Val128) rabbit pAb
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, mouse, rat
From 173.00€ *
Review
CTSW (Vector pUC, Accession No. BC048255)
CTSW (Vector pUC, Accession No. BC048255)

Item number: CSB-CL006205HU.10

Length: 1131 Sequence: atggcactga ctgcccaccc ctcctgcctc ctggccctgt tggtggcagg cctagcccaa ggcatcagag gcccccttag ggcccaggac ctaggtcccc agccgctaga gctgaaagag gccttcaagt tgttccagat ccagttcaac cggagttacc tgagcccaga agagcatgct caccgcctgg acatctttgc ccacaacctg gcccaggctc agaggctgca ggaggaggac ttgggcacag ctgagtttgg...
Keywords: CTSW, Lymphopain, EC=3.4.22.-, Cathepsin W
Application: Molecular biology, clone
Species reactivity: human
421.00€ *
Review
CTSW (human), recombinant protein
CTSW (human), recombinant protein

Item number: ABS-PP-11900.100

Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
Keywords: Cathepsin W, Lymphopain, Recombinant Human CTSW Protein
Expressed in: E.coli
Origin: human
MW: 40.5 kD
From 90.00€ *
Review
CTSW PrEST Antigen
CTSW PrEST Antigen

Item number: ATA-APrEST95971.100

PrEST Antigen CTSW, Gene description: cathepsin W, Antigen sequence: EEFGQLYGYRRAAGGVPSMGREIRSEEPEESVPFSCDWRKVAGAISPIKDQKNCNCCWAMAAAGNIETLWRISFWD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May have a specific function in the mechanism or regulation of T-cell...
Keywords: CTSW, Lymphopain, Cathepsin W, EC=3.4.22.-
Expressed in: E.coli
Origin: human
264.00€ *
Review
CTSW (human), recombinant protein
CTSW (human), recombinant protein

Item number: ABS-PP-11900-L.100

Protein function: May have a specific function in the mechanism or regulation of T-cell cytolytic activity. [The UniProt Consortium]
Keywords: Cathepsin W, Lymphopain, Recombinant Human CTSW Protein
Expressed in: E.coli
Origin: human
MW: 40.5 kD
From 115.00€ *
Review