16 products were found matching "GeneID 152015"!

1 from 2 pages
No results were found for the filter!
Anti-ROPN1B
Anti-ROPN1B

Item number: G-PACO29584.50

ROPN1B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ROPN1B Antibody is a high quality polyclonal antibody for research use only.. Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm...
Keywords: Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
313.00€ *
Review
Anti-ROPN1B
Anti-ROPN1B

Item number: ATA-HPA052530.100

Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative....
Keywords: Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B
Application: IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Ropporin-1B (ROPN1B), partial, human, recombinant
Ropporin-1B (ROPN1B), partial, human, recombinant

Item number: CSB-EP020065HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-120aa. Protein Length: Partial of Isoform 2. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MWKVVNLPTD LFNSVMNVGR FTEEIEWLKF LALACSALGV TITKTLKIVC EVLSCDHNGG LPRIPFSTFQ FLYTYIAEVD GEICASHVSR MLNYIEQEVI GPDGLITVND FTQNPRVWLE. Purity:...
Keywords: ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human Ropporin-1B (ROPN1B), partial
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 40.6 kD
From 219.00€ *
Review
Ropporin-1B (ROPN1B), human, recombinant
Ropporin-1B (ROPN1B), human, recombinant

Item number: CSB-YP020065HU.1

Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 1-120aa. Protein Length: Full Length of isoform 2. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MWKVVNLPTD LFNSVMNVGR FTEEIEWLKF LALACSALGV TITKTLKIVC EVLSCDHNGG LPRIPFSTFQ FLYTYIAEVD GEICASHVSR MLNYIEQEVI GPDGLITVND FTQNPRVWLE. Purity:...
Keywords: ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human Ropporin-1B (ROPN1B)
Application: Activity not tested
Expressed in: Yeast
Origin: human
MW: 15.6 kD
From 242.00€ *
Review
Anti-ROPN1B
Anti-ROPN1B

Item number: ATA-HPA052529.100

Rabbit Polyclonal ROPN1B Antibody against Human rhophilin associated tail protein 1B. Validated for Western Blot. Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Interspecies information: Highest antigen sequence indentity to the following orthologs: ENSMUSG00000022832: 94%,...
Keywords: Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B
Application: WB
Host: Rabbit
Species reactivity: human
463.00€ *
Review
ROPN1B,  Recombinant, Human, aa1-120, GST-Tag (Ropporin-1B)
ROPN1B, Recombinant, Human, aa1-120, GST-Tag (Ropporin-1B)

Item number: 375080.1

Source:, Recombinant protein corresponding to aa1-120 from human ROPN1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.6kD, AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE, Storage and Stability: May...
Keywords: ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B
MW: 40,6
From 603.00€ *
Review
ROPN1B PrEST Antigen
ROPN1B PrEST Antigen

Item number: ATA-APrEST82634.100

Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
ROPN1B, Recombinant, Human, aa1-120, His-Tag (Ropporin-1B)
ROPN1B, Recombinant, Human, aa1-120, His-Tag (Ropporin-1B)

Item number: 375081.100

Source:, Recombinant protein corresponding to aa1-120 from human Ropporin-1B, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.6kD, AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE, Storage and Stability:...
Keywords: ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B
MW: 15,6
From 557.00€ *
Review
Anti-ROP1B
Anti-ROP1B

Item number: ELK-ES13351.100

Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Cell projection,...
Keywords: Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, ROP1B rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
ROPN1B (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
ROPN1B (Vector Vector will be determined during the...

Item number: CSB-CL866334HU.10

Length: 363 Sequence: atgtggaaag tggtgaatct cccaacagat ctgtttaata gtgtgatgaa tgtgggtcgc ttcacggagg agatcgagtg gctgaagttt ttagcccttg cttgcagcgc tctgggagtt actattacca aaactctcaa gatagtgtgt gaggtcttat catgtgacca caatggtggg ttgccccgaa tcccattcag caccttccag tttctctaca cgtatattgc cgaagtggat ggggagatct gtgcatcaca...
Keywords: ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
Anti-ROPN1B, Biotin conjugated
Anti-ROPN1B, Biotin conjugated

Item number: CSB-PA020065ED01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ROPN1B. Antigen Species: Human
Keywords: Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, AKAP binding sperm protein ropporin antibody,...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-ROPN1B
Anti-ROPN1B

Item number: CSB-PA020065EA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ROPN1B. Antigen Species: Human
Keywords: Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, AKAP binding sperm protein ropporin antibody,...
Application: ELISA, IHC
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
1 from 2 pages