16 products were found matching "GeneID 152015"!
No results were found for the filter!
Anti-ROPN1B
Item number: ATA-HPA052529.100
Rabbit Polyclonal ROPN1B Antibody against Human rhophilin associated tail protein 1B. Validated for Western Blot. Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Interspecies information: Highest antigen sequence indentity to the following orthologs: ENSMUSG00000022832: 94%,...
| Keywords: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
463.00€
*
Anti-ROPN1B
Item number: G-PACO29584.50
ROPN1B Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. ROPN1B Antibody is a high quality polyclonal antibody for research use only.. Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm...
| Keywords: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Anti-ROPN1B
Item number: ATA-HPA052530.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative....
| Keywords: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Ropporin-1B (ROPN1B), partial, human, recombinant
Item number: CSB-EP020065HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 1-120aa. Protein Length: Partial of Isoform 2. Tag Info: N-terminal GST-tagged. Target Protein Sequence: MWKVVNLPTD LFNSVMNVGR FTEEIEWLKF LALACSALGV TITKTLKIVC EVLSCDHNGG LPRIPFSTFQ FLYTYIAEVD GEICASHVSR MLNYIEQEVI GPDGLITVND FTQNPRVWLE. Purity:...
| Keywords: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human Ropporin-1B (ROPN1B), partial |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 40.6 kD |
From 219.00€
*
Ropporin-1B (ROPN1B), human, recombinant
Item number: CSB-YP020065HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 1-120aa. Protein Length: Full Length of isoform 2. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MWKVVNLPTD LFNSVMNVGR FTEEIEWLKF LALACSALGV TITKTLKIVC EVLSCDHNGG LPRIPFSTFQ FLYTYIAEVD GEICASHVSR MLNYIEQEVI GPDGLITVND FTQNPRVWLE. Purity:...
| Keywords: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human Ropporin-1B (ROPN1B) |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 15.6 kD |
From 242.00€
*
ROPN1B (human), recombinant protein
Item number: ABS-PP-7271-L.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium]
| Keywords: | Ropporin-1B, Rhophilin-associated protein 1B, Recombinant Human ROPN1B Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 23.5 kD |
From 115.00€
*
ROPN1B, Recombinant, Human, aa1-120, GST-Tag (Ropporin-1B)
Item number: 375080.1
Source:, Recombinant protein corresponding to aa1-120 from human ROPN1B, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~40.6kD, AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE, Storage and Stability: May...
| Keywords: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| MW: | 40,6 |
From 603.00€
*
ROPN1B PrEST Antigen
Item number: ATA-APrEST82634.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
ROPN1B, Recombinant, Human, aa1-120, His-Tag (Ropporin-1B)
Item number: 375081.100
Source:, Recombinant protein corresponding to aa1-120 from human Ropporin-1B, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.6kD, AA Sequence: MWKVVNLPTDLFNSVMNVGRFTEEIEWLKFLALACSALGVTITKTLKIVCEVLSCDHNGGLPRIPFSTFQFLYTYIAEVDGEICASHVSRMLNYIEQEVIGPDGLITVNDFTQNPRVWLE, Storage and Stability:...
| Keywords: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| MW: | 15,6 |
From 557.00€
*
Anti-ROP1B
Item number: ELK-ES13351.100
Protein function: Important for male fertility. With ROPN1L, involved in fibrous sheath integrity and sperm motility, plays a role in PKA- dependent signaling processes required for spermatozoa capacitation. [The UniProt Consortium] Recommended dilutions: WB 1:500-2000. Cellular localization: Cell projection,...
| Keywords: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, ROP1B rabbit pAb |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human, rat, mouse, |
From 173.00€
*
ROPN1B (Vector Vector will be determined during the...
Item number: CSB-CL866334HU.10
Length: 363 Sequence: atgtggaaag tggtgaatct cccaacagat ctgtttaata gtgtgatgaa tgtgggtcgc ttcacggagg agatcgagtg gctgaagttt ttagcccttg cttgcagcgc tctgggagtt actattacca aaactctcaa gatagtgtgt gaggtcttat catgtgacca caatggtggg ttgccccgaa tcccattcag caccttccag tttctctaca cgtatattgc cgaagtggat ggggagatct gtgcatcaca...
| Keywords: | ROPN1B, Ropporin-1B, Rhophilin-associated protein 1B |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Anti-ROPN1B, Biotin conjugated
Item number: CSB-PA020065ED01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: ROPN1B. Antigen Species: Human
| Keywords: | Anti-ROPN1B, Anti-Ropporin-1B, Anti-Rhophilin-associated protein 1B, AKAP binding sperm protein ropporin antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*