- Search results for GeneID 149954
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
3 products were found matching "GeneID 149954"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA047388.100
Polyclonal Antibody against Human BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Validated applications: ICC, Uniprot ID: P59827, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
| Keywords: | Anti-BPIFB4, Anti-C20orf186, Anti-Ligand-binding protein RY2G5, Anti-BPI fold-containing family B member 4, Anti-Long... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: CSB-EL003694HU.48
Sample Types: serum, plasma, tissue homogenates Detection Range: 25 pg/mL-1600 pg/mL Sensitivity: 6.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May have the capacity to recognize and bind specific classes of...
| Keywords: | BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal... |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | human |
From 581.00€
*
Item number: ATA-APrEST95860.100
PrEST Antigen BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Antigen sequence: PKDLETTICLIDVDTELLASFSIEGDKLMIDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
| Keywords: | BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
