3 products were found matching "GeneID 149954"!

No results were found for the filter!
Anti-BPIFB4
Anti-BPIFB4

Item number: ATA-HPA047388.100

Polyclonal Antibody against Human BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Validated applications: ICC, Uniprot ID: P59827, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May...
Keywords: Anti-BPIFB4, Anti-C20orf186, Anti-Ligand-binding protein RY2G5, Anti-BPI fold-containing family B member 4, Anti-Long...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Human Long palate, lung and nasal epithelium carcinoma-associated protein 4 (C20orf186) ELISA kit
Human Long palate, lung and nasal epithelium...

Item number: CSB-EL003694HU.48

Sample Types: serum, plasma, tissue homogenates Detection Range: 25 pg/mL-1600 pg/mL Sensitivity: 6.25 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: May have the capacity to recognize and bind specific classes of...
Keywords: BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal...
Application: ELISA, Sandwich ELISA
Species reactivity: human
From 581.00€ *
Review
BPIFB4 PrEST Antigen
BPIFB4 PrEST Antigen

Item number: ATA-APrEST95860.100

PrEST Antigen BPIFB4, Gene description: BPI fold containing family B member 4, Alternative Gene Names: C20orf186, dJ726C3.5, LPLUNC4, Antigen sequence: PKDLETTICLIDVDTELLASFSIEGDKLMIDAKLEKTSLNLRTSNVGNFDIGLMEVLVEKIFDLAFMPAMNAVLG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: BPIFB4, C20orf186, Ligand-binding protein RY2G5, BPI fold-containing family B member 4, Long palate, lung and nasal...
Expressed in: E.coli
Origin: human
264.00€ *
Review