- Search results for GeneID 147409
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 147409"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA059456.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: 40% glycerol and...
| Keywords: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Item number: ABS-PP-539.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Keywords: | Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21 kD |
From 90.00€
*
Item number: ATA-HPA079244.100
Polyclonal Antibody against Human DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Validated applications: IHC, Uniprot ID: Q86SJ6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of intercellular desmosome junctions....
| Keywords: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ABS-KC-32557.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Keywords: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-KC-32659.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Keywords: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-KC-32679.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Keywords: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13 |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Item number: ABS-PP-539-L.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium]
| Keywords: | Desmoglein-4, Cadherin family member 13, Recombinant Human DSG4 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 21 kD |
From 115.00€
*
Item number: D3221-85.100
Desmoglein-4 is ~110kD type I transmembrane glycoprotein in the cadherin family of calcium-dependent cell adhesion molecules. Desmogleins interact with transmembrane Desmocollins to form the adhesive components of desmosomes on epithelial cells. Desmoglein-4 contains four cadherin repeats in its extracellular region...
| Application: | WB |
| Host: | Sheep |
| Species reactivity: | human |
1,025.00€
*
Item number: ATA-APrEST85759.100
Protein function: Component of intercellular desmosome junctions. Involved in the interaction of plaque proteins and intermediate filaments mediating cell-cell adhesion. Coordinates the transition from proliferation to differentiation in hair follicle keratinocytes. [The UniProt Consortium] Buffer: PBS and 1M Urea,...
| Keywords: | DSG4, CDHF13, Desmoglein-4, Cadherin family member 13 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES9587.100
This gene encodes a member of the desmoglein subgroup of desmosomal cadherins. The encoded preproprotein is proteolytically processed to generate the mature protein. This protein is a transmembrane component of desmosomes and may play a role in cell-cell adhesion in epithelial cells. Mutations in the gene are...
| Keywords: | Anti-DSG4, Anti-CDHF13, Anti-Desmoglein-4, Anti-Cadherin family member 13, DSG4 rabbit pAb |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse, rat |
From 173.00€
*
Item number: ATA-APrEST95823.100
PrEST Antigen DSG4, Gene description: desmoglein 4, Alternative Gene Names: CDHF13, LAH, Antigen sequence: PAELADYNNVIYAERVLASPGVPDMSNSSTTEGCMGPVMSGNILVGPEIQVMQMMSPDLPIGQTVGSTSPMTSRHRVTRYSNIHYTQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of intercellular...
| Keywords: | DSG4, CDHF13, Desmoglein-4, Cadherin family member 13 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*