12 products were found matching "GeneID 145942"!

No results were found for the filter!
Anti-TMCO5A
Anti-TMCO5A

Item number: G-PACO39098.50

TMCO5A Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB, IHC, IF applications. TMCO5A Antibody is a high quality polyclonal antibody for research use only.
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A
Application: ELISA, WB, IHC, IF
Host: Rabbit
Species reactivity: human
313.00€ *
Review
Anti-TMCO5A
Anti-TMCO5A

Item number: ATA-HPA056530.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 86% and to rat: 89%
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A
Application: IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Anti-TMCO5A
Anti-TMCO5A

Item number: ATA-HPA064017.100

Polyclonal Antibody against Human TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Validated applications: ICC, Uniprot ID: Q8N6Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 71% Rat gene...
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
TMCO5A (human), recombinant protein
TMCO5A (human), recombinant protein

Item number: ABS-PP-4525-L.100

Keywords: Transmembrane and coiled-coil domain-containing protein 5A, Recombinant Human TMCO5A Protein
Expressed in: E.coli
Origin: human
MW: 27.5 kD
From 115.00€ *
Review
TMCO5A PrEST Antigen
TMCO5A PrEST Antigen

Item number: ATA-APrEST85678.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
TMCO5A (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC,
TMCO5A (Vector Vector will be determined during the...

Item number: CSB-CL843283HU.10

Length: 867 Sequence: atggaaatct caagattggc tcagtcaaaa agaaacatta tcagtttgaa catggacctt gaaagggata cgcagagaat agatgaagca aaccagaaac ttcttctcaa aatccaagag agggaagata agattcagag gctggaaagt gagatcattc agacgcgggg cctggtggaa gatgaagagt gggagaagga gaaccgcacc acgatggaaa gggaaagagc cttgcaggag ctggaggaag aaacagccag...
Keywords: TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
Anti-TMCO5A
Anti-TMCO5A

Item number: CSB-PA843283LA01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,...
Application: ELISA, WB, IHC, IF
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-TMCO5A, HRP conjugated
Anti-TMCO5A, HRP conjugated

Item number: CSB-PA843283LB01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-TMCO5A, FITC conjugated
Anti-TMCO5A, FITC conjugated

Item number: CSB-PA843283LC01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,...
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
Anti-TMCO5A, Biotin conjugated
Anti-TMCO5A, Biotin conjugated

Item number: CSB-PA843283LD01HU.100

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
Keywords: Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,...
Application: ELISA
Host: Rabbit
Species reactivity: human
From 167.00€ *
Review
TMCO5A (human), recombinant protein
TMCO5A (human), recombinant protein

Item number: ABS-PP-4525.100

Keywords: Transmembrane and coiled-coil domain-containing protein 5A, Recombinant Human TMCO5A Protein
Expressed in: E.coli
Origin: human
MW: 27.5 kD
From 90.00€ *
Review
TMCO5A PrEST Antigen
TMCO5A PrEST Antigen

Item number: ATA-APrEST95787.100

PrEST Antigen TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Antigen sequence: EETKVKLQQLEASYACQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 71%...
Keywords: TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A
Expressed in: E.coli
Origin: human
264.00€ *
Review