- Search results for GeneID 145942
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "GeneID 145942"!
Close filters
Filter by:
No results were found for the filter!
Item number: G-PACO39098.50
TMCO5A Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, WB, IHC, IF applications. TMCO5A Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Item number: ATA-HPA056530.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 86% and to rat: 89%
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: ATA-HPA064017.100
Polyclonal Antibody against Human TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Validated applications: ICC, Uniprot ID: Q8N6Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 71% Rat gene...
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA064017.25
Polyclonal Antibody against Human TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Validated applications: ICC, Uniprot ID: Q8N6Q1, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 71% Rat gene...
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: ATA-APrEST85678.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: CSB-CL843283HU.10
Length: 867 Sequence: atggaaatct caagattggc tcagtcaaaa agaaacatta tcagtttgaa catggacctt gaaagggata cgcagagaat agatgaagca aaccagaaac ttcttctcaa aatccaagag agggaagata agattcagag gctggaaagt gagatcattc agacgcgggg cctggtggaa gatgaagagt gggagaagga gaaccgcacc acgatggaaa gggaaagagc cttgcaggag ctggaggaag aaacagccag...
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA843283LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Application: | ELISA, WB, IHC, IF |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA843283LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA843283LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA843283LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: TMCO5A. Antigen Species: Human
| Keywords: | Anti-TMCO5, Anti-TMCO5A, Anti-Transmembrane and coiled-coil domain-containing protein 5A, TMCO5A antibody, TMCO5 antibody,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: ABS-PP-4525.100
| Keywords: | Transmembrane and coiled-coil domain-containing protein 5A, Recombinant Human TMCO5A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27.5 kD |
From 90.00€
*
Item number: ATA-APrEST95787.100
PrEST Antigen TMCO5A, Gene description: transmembrane and coiled-coil domains 5A, Alternative Gene Names: MGC35118, TMCO5, Antigen sequence: EETKVKLQQLEASYACQEKELLKVMKEYAFVTQLCEDQALYIKKYQETLKKIEEELEALFLEREVSKLVSMNPVE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 71%...
| Keywords: | TMCO5, TMCO5A, Transmembrane and coiled-coil domain-containing protein 5A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*