6 products were found matching "GeneID 140873"!

No results were found for the filter!
Anti-C20orf173
Anti-C20orf173

Item number: ATA-HPA076859.100

Polyclonal Antibody against Human C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Validated applications: ICC, Uniprot ID: Q96LM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 31% Rat gene...
Keywords: Anti-C20orf173, Anti-Uncharacterized protein C20orf173
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-C20orf173
Anti-C20orf173

Item number: ATA-HPA076859.25

Polyclonal Antibody against Human C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Validated applications: ICC, Uniprot ID: Q96LM9, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 31% Rat gene...
Keywords: Anti-C20orf173, Anti-Uncharacterized protein C20orf173
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
C20orf173, Human chromosome 20 open reading frame 173, Real Time PCR Primer Set
C20orf173, Human chromosome 20 open reading frame 173,...

Item number: VHPS-1184

Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
Keywords: C20orf173
Application: RNA quantification
45.00€ *
Review
Anti-CT173, ID (C20orf173, Uncharacterized protein C20orf173)
Anti-CT173, ID (C20orf173, Uncharacterized protein...

Item number: 034312.200

Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
Keywords: Anti-C20orf173, Anti-Uncharacterized protein C20orf173
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
Anti-CT173
Anti-CT173

Item number: ELK-ES17195.100

Recommended dilutions: WB 1:500-2000. Cellular localization: integral component of membrane,
Keywords: Anti-C20orf173, Anti- C20orf173, CT173 rabbit pAb
Application: WB
Host: Rabbit
Species reactivity: human, rat, mouse,
From 173.00€ *
Review
C20orf173 PrEST Antigen
C20orf173 PrEST Antigen

Item number: ATA-APrEST96207.100

PrEST Antigen C20orf173, Gene description: chromosome 20 open reading frame 173, Alternative Gene Names: dJ477O4.4, Antigen sequence: VLLGRPQIPQGSSLGNDIDQYPVVFRNASDQGSWMQLEMLLRKLSDLVWTSDALSDKILED, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 31% Rat gene identity: 31%
Keywords: C20orf173, Uncharacterized protein C20orf173
Expressed in: E.coli
Origin: human
264.00€ *
Review