- Search results for GeneID 13214
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 13214"!
Close filters
Filter by:
No results were found for the filter!
Item number: 97410.1
Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
| Keywords: | Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822. |
| Application: | Cell Culture |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 4100 D |
From 105.00€
*
Item number: G-MOFI00227.96
| Application: | ELISA |
| Species reactivity: | mouse |
698.00€
*
Item number: CSB-EP006662MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 33-69aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: DQYKCLQHGG FCLRSSCPSN TKLQGTCKPD KPNCCKS. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological...
| Keywords: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1, Recombinant Mouse Beta-defensin 1 (Defb1) |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 20.1 kD |
From 364.00€
*
Item number: TGM-TMPH-02541-100ug
Description: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
| Keywords: | Defb1, Defensin, beta 1, Beta-defensin 1, mBD-1, BD-1 |
| MW: | 20.1 kD |
From 340.00€
*
Item number: TGM-TMPH-02541-10ug
Description: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
| Keywords: | Defensin, beta 1 , mBD-1 , Beta-defensin 1 , BD-1 , Defb1 |
| MW: | 20.1 kD |
From 122.00€
*
Item number: G-AEKE04319.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse DEFb1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse DEFb1. Next,...
| Keywords: | Defb1, Beta-defensin 1, Defensin, beta 1 |
| Application: | ELISA |
| Species reactivity: | rat |
694.00€
*
Item number: CSB-E14188m.48
Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 15.6 pg/mL-1000 pg/mL Sensitivity: 3.9 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Has bactericidal activity. May act as a...
| Keywords: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | mouse |
From 658.00€
*
Item number: ELK-ELK10385.48
Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility Assay Type: Sandwich. Sensitivity: 12.7 pg/mL....
| Keywords: | Defb1, Beta-defensin 1, Defensin, beta 1 |
| Application: | ELISA |
| Species reactivity: | mouse |
From 374.00€
*
Item number: 024598.96
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
| Keywords: | BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1 |
| Application: | ELISA |
| Species reactivity: | mouse |
1,113.00€
*
Item number: 372437.100
Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
| Keywords: | BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1 |
| MW: | 20,1 |
From 786.00€
*
Item number: CSB-PA006662ZA01MO.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-BD-1, Anti-Defb1, Anti-mBD-1, Anti-Beta-defensin 1, Anti-Defensin, beta 1, Defb1 Antibody |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Mus musculus (Mouse) |
From 1,529.00€
*