11 products were found matching "GeneID 13214"!

No results were found for the filter!
Beta Defensin-1, mouse recombinant (rHuBD-1)
Beta Defensin-1, mouse recombinant (rHuBD-1)

Item number: 97410.1

Mouse recombinant BD 1 produced in E.coli is a single, non-glycosylated, polypeptide chain containing 37 amino acids and having a molecular mass of 4.1 kDa. The Defensin family are highly similar in their protein sequence and are microbicidal and cytotoxic peptides made by neutrophils. Beta Defensin-1 is an...
Keywords: Beta-defensin 1, BD-1, Defensin beta 1, hBD-1, HBD1, HBP1, DEFB1, HBD-1, HBP-1, DEFB101, DEFB-1, MGC51822.
Application: Cell Culture
Expressed in: E.coli
Origin: mouse
MW: 4100 D
From 105.00€ *
Review
Mouse BD-1 /  beta Defensin 1 ELISA Kit
Mouse BD-1 / beta Defensin 1 ELISA Kit

Item number: G-MOFI00227.96

Application: ELISA
Species reactivity: mouse
698.00€ *
Review
Beta-defensin 1 (Defb1), mouse, recombinant
Beta-defensin 1 (Defb1), mouse, recombinant

Item number: CSB-EP006662MO.1

Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 33-69aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: DQYKCLQHGG FCLRSSCPSN TKLQGTCKPD KPNCCKS. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test. Biological...
Keywords: BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1, Recombinant Mouse Beta-defensin 1 (Defb1)
Application: Activity not tested
Expressed in: E.coli
Origin: mouse
MW: 20.1 kD
From 364.00€ *
Review
Beta Defensin 1/DEFB1 Protein, Mouse, Recombinant (His & SUMO)
Beta Defensin 1/DEFB1 Protein, Mouse, Recombinant (His &...

Item number: TGM-TMPH-02541-100ug

Description: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Keywords: Defb1, Defensin, beta 1, Beta-defensin 1, mBD-1, BD-1
MW: 20.1 kD
From 340.00€ *
Review
DEFB1 Protein, Mouse, Recombinant (His & SUMO)
DEFB1 Protein, Mouse, Recombinant (His & SUMO)

Item number: TGM-TMPH-02541-10ug

Description: Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility.
Keywords: Defensin, beta 1 , mBD-1 , Beta-defensin 1 , BD-1 , Defb1
MW: 20.1 kD
From 122.00€ *
Review
Mouse DEFb1 (Defensin Beta 1) ELISA Kit
Mouse DEFb1 (Defensin Beta 1) ELISA Kit

Item number: G-AEKE04319.96

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Mouse DEFb1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Mouse DEFb1. Next,...
Keywords: Defb1, Beta-defensin 1, Defensin, beta 1
Application: ELISA
Species reactivity: rat
694.00€ *
Review
Mouse beta-defensins 1 ELISA Kit
Mouse beta-defensins 1 ELISA Kit

Item number: CSB-E14188m.48

Sample Types: serum, plasma, cell culture supernates, tissue homogenates Detection Range: 15.6 pg/mL-1000 pg/mL Sensitivity: 3.9 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Has bactericidal activity. May act as a...
Keywords: BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1
Application: ELISA, Sandwich ELISA
Species reactivity: mouse
From 658.00€ *
Review
Mouse DEFb1(Defensin Beta 1) ELISA Kit
Mouse DEFb1(Defensin Beta 1) ELISA Kit

Item number: ELK-ELK10385.48

Has bactericidal activity. May act as a ligand for C-C chemokine receptor CCR6. Positively regulates the sperm motility and bactericidal activity in a CCR6-dependent manner. Binds to CCR6 and triggers Ca2+ mobilization in the sperm which is important for its motility Assay Type: Sandwich. Sensitivity: 12.7 pg/mL....
Keywords: Defb1, Beta-defensin 1, Defensin, beta 1
Application: ELISA
Species reactivity: mouse
From 374.00€ *
Review
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)
Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse)

Item number: 024598.96

Defensin Beta 1 (DEFb1) BioAssay(TM) ELISA Kit (Mouse) is a sandwich enzyme immunoassay for in vitro quantitative measurement of DEFb1 in mouse serum, plasma and other biological fluids. Detection Range: 0.78-50ng/ml, Sensitivity: 0.28ng/ml, Storage and Stability: Desiccation recommended. The Standard, Detection...
Keywords: BD-1, Defb1, mBD-1, Beta-defensin 1, Defensin, beta 1
Application: ELISA
Species reactivity: mouse
1,113.00€ *
Review
Beta-defensin 1, Recombinant, Mouse, aa33-69, His-SUMO-Tag (Defb1)
Beta-defensin 1, Recombinant, Mouse, aa33-69,...

Item number: 372437.100

Has bactericidal activity. Source: Recombinant protein corresponding to aa33-69 from mouse Defb1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~20.1kD, AA Sequence: DQYKCLQHGGFCLRSSCPSNTKLQGTCKPDKPNCCKS, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
Keywords: BD-1, mBD-1, Defb1, Beta-defensin 1, Defensin, beta 1
MW: 20,1
From 786.00€ *
Review
Anti-Defb1
Anti-Defb1

Item number: CSB-PA006662ZA01MO.100

Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
Keywords: Anti-BD-1, Anti-Defb1, Anti-mBD-1, Anti-Beta-defensin 1, Anti-Defensin, beta 1, Defb1 Antibody
Application: ELISA, WB
Host: Rabbit
Species reactivity: Mus musculus (Mouse)
From 1,529.00€ *
Review