- Search results for GeneID 128308
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
11 products were found matching "GeneID 128308"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA027641.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 79% and to rat: 78%
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ICC, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-EP014872HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 34-128aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal GST-tagged. Target Protein Sequence: DSSRASLTRV HRQAYARLYP VLLVKQDGST IHIRYREPRR MLAMPIDLDT LSPEERRARL RKREAQLQSR KEYEQELSDD LHVERYRQFW TRTKK. Purity: Greater than 90% as...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 38.6 kD |
From 219.00€
*
Item number: 374273.1
Source:, Recombinant protein corresponding to aa34-128 from human MRPL55, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~38.6kD, AA Sequence: DSSRASLTRVHRQAYARLYPVLLVKQDGSTIHIRYREPRRMLAMPIDLDTLSPEERRARLRKREAQLQSRKEYEQELSDDLHVERYRQFWTRTKK, Storage and Stability: May be stored at 4°C for...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| MW: | 38,6 |
From 603.00€
*
Item number: ATA-APrEST77022.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: G-CAB18242.20
MRPL55 Rabbit Polyclonal Antibody from Assay Genie with reactivity against Human and for use in WB applications.MRPL55 Rabbit Polyclonal Antibody is an IgG isotype antibody and produced in Rabbit and purified by Affinity purification from Assay Genie.
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | WB |
| Host: | Rabbit |
| Species reactivity: | human |
103.00€
*
Item number: ELK-ES9307.100
Mammalian mitochondrial ribosomal proteins are encoded by nuclear genes and help in protein synthesis within the mitochondrion. Mitochondrial ribosomes (mitoribosomes) consist of a small 28S subunit and a large 39S subunit. They have an estimated 75% protein to rRNA composition compared to prokaryotic ribosomes,...
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-Large ribosomal subunit protein mL55, Anti-39S ribosomal protein L55,... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: CSB-CL768781HU.10
Length: 387 Sequence: atggcggccg tgggcagcct gcttggccgg ctgaggcaga gcaccgtgaa ggccaccgga cctgcactcc gccgcctgca cacatcctcc tggcgagctg acagcagcag ggcctcactc actcgtgtgc accgccaggc ttatgcacga ctctaccccg tgctgctggt gaagcaggat ggctccacca tccacatccg ctacagggag ccacggcgca tgctggcgat gcccatagat ctggacaccc tgtctcctga...
| Keywords: | L55mt, MRPL55, MRP-L55, 39S ribosomal protein L55, mitochondrial, Mitochondrial large ribosomal subunit protein mL55,... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
Item number: CSB-PA014872EA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA, WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA014872EC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA014872EB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Item number: CSB-PA014872ED01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: MRPL55. Antigen Species: Human
| Keywords: | Anti-L55mt, Anti-MRPL55, Anti-MRP-L55, Anti-39S ribosomal protein L55, mitochondrial, Anti-Mitochondrial large ribosomal... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*