14 products were found matching "GeneID 1262"!
No results were found for the filter!
Cyclic nucleotide-gated cation channel alpha-4 (CNGA4),...
Item number: CSB-CF808540HU.100
Organism: Homo sapiens (Human). Source: in vitro E.coli expression system. Expression Region: 1-575aa. Protein Length: Full Length. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MSQDTKVKTT ESSPPAPSKA RKLLPVLDPS GDYYYWWLNT MVFPVMYNLI ILVCRACFPD LQHGYLVAWL VLDYTSDLLY LLDMVVRFHT GFLEQGILVV DKGRISSRYV...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Application: | Activity not tested |
| Expressed in: | E.coli in vitro |
| Origin: | human |
| MW: | 82 kD |
From 1,458.00€
*
Anti-CNGA4
Item number: ATA-HPA074128.100
Polyclonal Antibody against Human CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Validated applications: ICC, Uniprot ID: Q8IV77, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
| Keywords: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
CNGA4 (human), recombinant protein
Item number: ABS-PP-2427-L.100
Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
| Keywords: | Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 29 kD |
From 115.00€
*
Anti-CNGA4, NT (CNGA4, Cyclic nucleotide-gated cation...
Item number: 034039.200
CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500,...
| Keywords: | Anti-CNG4, Anti-CNGA4, Anti-CNG-4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | mouse |
865.00€
*
CNGA4 (Vector Vector will be determined during the...
Item number: CSB-CL808540HU.10
Length: 1728 Sequence: ATGAGCCAGG ACACCAAAGT GAAGACAACA GAGTCCAGTC CCCCAGCCCC ATCCAAGGCC AGGAAGTTGC TGCCTGTCCT GGACCCATCT GGGGATTACT ACTACTGGTG GCTGAACACA ATGGTCTTCC CAGTCATGTA TAACCTCATC ATCCTCGTGT GCAGAGCCTG CTTCCCCGAC TTGCAGCACG GTTATCTGGT GGCCTGGTTG GTGCTGGACT ACACGAGTGA CCTGCTATAC CTACTAGACA TGGTGGTGCG...
| Keywords: | CNG4, CNG-4, CNGA4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
357.00€
*
Anti-CNGA4
Item number: CSB-PA808540LA01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-CNGA4, HRP conjugated
Item number: CSB-PA808540LB01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-CNGA4, FITC conjugated
Item number: CSB-PA808540LC01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
Anti-CNGA4, Biotin conjugated
Item number: CSB-PA808540LD01HU.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: CNGA4. Antigen Species: Human
| Keywords: | Anti-CNG4, Anti-CNG-4, Anti-CNGA4, Anti-CNG channel alpha-4, Anti-Cyclic nucleotide-gated channel alpha-4, Anti-Cyclic... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | human |
From 167.00€
*
CNGA4 (human), recombinant protein
Item number: ABS-PP-2427.100
Protein function: Second messenger, cAMP, causes the opening of cation- selective cyclic nucleotide-gated (CNG) channels and depolarization of the neuron (olfactory sensory neurons, OSNs). CNGA4 is the modulatory subunit of this channel which is known to play a central role in the transduction of odorant signals and...
| Keywords: | Cyclic nucleotide-gated cation channel alpha-4, Cyclic nucleotide-gated channel alpha-4, CNG channel alpha-4, CNG-4, CNG4,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 29 kD |
From 90.00€
*
CNGA4 PrEST Antigen
Item number: ATA-APrEST95627.100
PrEST Antigen CNGA4, Gene description: cyclic nucleotide gated channel subunit alpha 4, Alternative Gene Names: CNCA2, CNG5, CNGB2, OCNC2, OCNCb, Antigen sequence: LLAELESSALKIAYRIERLEWQTREWPMPEDLAEADDEGEPEEGTSKDEEGRAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Human CNGA4-Strep full length protein-synthetic nanodisc
Item number: DIM-FLP120748.10
CNGA4 is a modulatory subunit of vertebrate cyclic nucleotide-gated membrane channels that transduce odorant signals (Munger et al., 2001 [PubMed 11739959]).[supplied by OMIM, Mar 2008]. Human CNGA4-Strep full length protein-synthetic nanodisc. Protein function: Second messenger, cAMP, causes the opening of cation-...
| Keywords: | CNG4, CNGA4, CNG-4, CNG channel alpha-4, Cyclic nucleotide-gated channel alpha-4, Cyclic nucleotide-gated cation channel... |
| Application: | Full length transmembrane protein, FA, ELISA, screening, immunization, cell-based assays, crystallization |
| Expressed in: | Human cells |
| Origin: | human |
| MW: | 66 kD |
From 1,185.00€
*