- Search results for GeneID 124739
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
14 products were found matching "GeneID 124739"!
Close filters
Filter by:
No results were found for the filter!
Item number: TGM-TMPH-04177-100ug
Description: USP43 Protein, Human, Recombinant (His) is expressed in E. coli with N-10xHis. The accession number is Q70EL4.
| Keywords: | USP43 , Ubiquitin carboxyl-terminal hydrolase 43 , Ubiquitin-specific-processing protease 43 , Deubiquitinating enzyme 43... |
| MW: | 74.5 kD |
From 93.00€
*
Item number: ATA-HPA023389.100
Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Item number: CSB-EP758219HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 101-710aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: QGLKNHGNTC FMNAVVQCLS NTDLLAEFLA LGRYRAAPGR AEVTEQLAAL VRALWTREYT PQLSAEFKNA VSKYGSQFQG NSQHDALEFL LWLLDRVHED LEGSSRGPVS EKLPPEATKT SENCLSPSAQ LPLGQSFVQS...
| Keywords: | USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 74.5 kD |
From 292.00€
*
Item number: CSB-PA007025.100
Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 126.00€
*
Item number: CSB-PA153033.100
Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
284.00€
*
Item number: ATA-HPA027763.100
Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: ICC, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May recognize and hydrolyze the...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA027763.25
Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: ICC, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May recognize and hydrolyze the...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: 043673.200
USP43 may recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins (By similarity). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000,...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
Item number: ATA-APrEST75715.100
Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ELK-ES4716.100
catalytic activity:Ubiquitin C-terminal thioester + H(2)O = ubiquitin + a thiol.,function:May recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins.,similarity:Belongs to the peptidase C19...
| Keywords: | Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin... |
| Application: | WB, ELISA |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
Item number: ABS-PP-7433.100
Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium]
| Keywords: | Ubiquitin carboxyl-terminal hydrolase 43, Deubiquitinating enzyme 43, Ubiquitin thioesterase 43,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 19.5 kD |
From 90.00€
*
Item number: ATA-APrEST96126.100
PrEST Antigen USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Antigen sequence: EEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKD, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*