14 products were found matching "GeneID 124739"!

1 from 2 pages
No results were found for the filter!
USP43 Protein, Human, Recombinant (His)
USP43 Protein, Human, Recombinant (His)

Item number: TGM-TMPH-04177-100ug

Description: USP43 Protein, Human, Recombinant (His) is expressed in E. coli with N-10xHis. The accession number is Q70EL4.
Keywords: USP43 , Ubiquitin carboxyl-terminal hydrolase 43 , Ubiquitin-specific-processing protease 43 , Deubiquitinating enzyme 43...
MW: 74.5 kD
From 93.00€ *
Review
Anti-USP43
Anti-USP43

Item number: ATA-HPA023389.100

Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Ubiquitin carboxyl-terminal hydrolase 43 (USP43), Partial, human, recombinant
Ubiquitin carboxyl-terminal hydrolase 43 (USP43),...

Item number: CSB-EP758219HU.1

Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 101-710aa. Protein Length: Partial. Tag Info: N-terminal 10xHis-tagged. Target Protein Sequence: QGLKNHGNTC FMNAVVQCLS NTDLLAEFLA LGRYRAAPGR AEVTEQLAAL VRALWTREYT PQLSAEFKNA VSKYGSQFQG NSQHDALEFL LWLLDRVHED LEGSSRGPVS EKLPPEATKT SENCLSPSAQ LPLGQSFVQS...
Keywords: USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,...
Application: Activity not tested
Expressed in: E.coli
Origin: human
MW: 74.5 kD
From 292.00€ *
Review
Anti-USP43
Anti-USP43

Item number: CSB-PA007025.100

Host Species: Rabbit. Isotype: IgG. Buffer: Liquid in PBS containing 50% glycerol, 0.5% BSA and 0.02% sodium azide. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by affinity-chromatography using epitope-specific...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
From 126.00€ *
Review
Anti-USP43
Anti-USP43

Item number: CSB-PA153033.100

Host Species: Rabbit. Isotype: IgG. Buffer: Rabbit IgG in phosphate buffered saline (without Mg2+ and Ca2+), pH 7.4, 150mM NaCl, 0.02% sodium azide and 50% glycerol. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: The antibody was affinity-purified from rabbit antiserum by...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human, mouse
284.00€ *
Review
Anti-USP43
Anti-USP43

Item number: ATA-HPA027763.100

Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: ICC, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May recognize and hydrolyze the...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-USP43
Anti-USP43

Item number: ATA-HPA027763.25

Polyclonal Antibody against Human USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Validated applications: ICC, Uniprot ID: Q70EL4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May recognize and hydrolyze the...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
Anti-USP43, CT (USP43, Ubiquitin carboxyl-terminal hydrolase 43, Deubiquitinating enzyme 43, Ubiquit
Anti-USP43, CT (USP43, Ubiquitin carboxyl-terminal...

Item number: 043673.200

USP43 may recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins (By similarity). Applications: Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000,...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
USP43 PrEST Antigen
USP43 PrEST Antigen

Item number: ATA-APrEST75715.100

Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
Keywords: USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-USP43
Anti-USP43

Item number: ELK-ES4716.100

catalytic activity:Ubiquitin C-terminal thioester + H(2)O = ubiquitin + a thiol.,function:May recognize and hydrolyze the peptide bond at the C-terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquinated proteins.,similarity:Belongs to the peptidase C19...
Keywords: Anti-USP43, EC=3.4.19.12, Anti-Ubiquitin thioesterase 43, Anti-Deubiquitinating enzyme 43, Anti-Ubiquitin...
Application: WB, ELISA
Host: Rabbit
Species reactivity: human, mouse
From 173.00€ *
Review
USP43 (human), recombinant protein
USP43 (human), recombinant protein

Item number: ABS-PP-7433.100

Protein function: May recognize and hydrolyze the peptide bond at the C- terminal Gly of ubiquitin. Involved in the processing of poly-ubiquitin precursors as well as that of ubiquitinated proteins. [The UniProt Consortium]
Keywords: Ubiquitin carboxyl-terminal hydrolase 43, Deubiquitinating enzyme 43, Ubiquitin thioesterase 43,...
Expressed in: E.coli
Origin: human
MW: 19.5 kD
From 90.00€ *
Review
USP43 PrEST Antigen
USP43 PrEST Antigen

Item number: ATA-APrEST96126.100

PrEST Antigen USP43, Gene description: ubiquitin specific peptidase 43, Alternative Gene Names: FLJ30626, Antigen sequence: EEDLNTIAEGDNVYAFQVPPSPSQGTLSAHPLGLSASPRLAAREGQRFSLSLHSESKVLILFCNLVGSGQQASRFGPPFLIREDRAVSWAQLQQSILSKVRHLMKSEAPVQNLGSLFSIRVVGLSVACSYLSPKD, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: USP43, EC=3.4.19.12, Ubiquitin thioesterase 43, Deubiquitinating enzyme 43, Ubiquitin carboxyl-terminal hydrolase 43,...
Expressed in: E.coli
Origin: human
264.00€ *
Review
1 from 2 pages