6 products were found matching "GeneID 122945"!
No results were found for the filter!
Anti-NOXRED1
Item number: ATA-HPA055658.100
Protein function: Probable oxidoreductase. [The UniProt Consortium] Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 64% and to rat: 66%
| Keywords: | Anti-NOXRED1, Anti-C14orf148, EC=1.-.-.-, Anti-Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-NOXRED1
Item number: ATA-HPA060408.100
Polyclonal Antibody against Human NOXRED1, Gene description: NADP dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Validated applications: ICC, Uniprot ID: Q6NXP6, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function:...
| Keywords: | Anti-NOXRED1, Anti-C14orf148, EC=1.-.-.-, Anti-Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NOXRED1 (human), recombinant protein
Item number: ABS-PP-6992-L.100
Protein function: Probable oxidoreductase. [The UniProt Consortium]
| Keywords: | NADP-dependent oxidoreductase domain-containing protein 1, Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27 kD |
From 115.00€
*
NOXRED1 PrEST Antigen
Item number: ATA-APrEST83676.100
Protein function: Probable oxidoreductase. [The UniProt Consortium] Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | NOXRED1, C14orf148, EC=1.-.-.-, Pyrroline-5-carboxylate reductase-like protein C14orf148, NADP-dependent oxidoreductase... |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
NOXRED1 (human), recombinant protein
Item number: ABS-PP-6992.100
Protein function: Probable oxidoreductase. [The UniProt Consortium]
| Keywords: | NADP-dependent oxidoreductase domain-containing protein 1, Pyrroline-5-carboxylate reductase-like protein C14orf148,... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 27 kD |
From 90.00€
*
NOXRED1 PrEST Antigen
Item number: ATA-APrEST96008.100
PrEST Antigen NOXRED1, Gene description: NADP dependent oxidoreductase domain containing 1, Alternative Gene Names: C14orf148, FLJ32809, Antigen sequence: LGIKCFYHNADLVSWADVIFLCCLPSQLPNICVEIYTSLEKASIVYSFVAAIPLPRLKLLLNHTNILRPQYQYDEDSVSVWGANKGVIAALQDPTILQATC, Storage: Upon delivery store at -20°C. Avoid repeated...
| Keywords: | NOXRED1, C14orf148, EC=1.-.-.-, Pyrroline-5-carboxylate reductase-like protein C14orf148, NADP-dependent oxidoreductase... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*