16 products were found matching "GeneID 122622"!
No results were found for the filter!
Anti-ADSS1
Item number: ATA-HPA052621.100
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-ADSS1
Item number: ATA-HPA052621.25
Polyclonal Antibody against Human ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Validated applications: IHC, Uniprot ID: Q8N142, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Component of the purine...
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-M-type adenylosuccinate synthetase,... |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Anti-ADSSL1, NT (ADSSL1, ADSS1, Adenylosuccinate...
Item number: 031666-FITC.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, FLISA, Recommended Dilution: FLISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: Store product at 4°C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated...
| Keywords: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Application: | FLISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
1,104.00€
*
Anti-ADSSL1, NT (ADSSL1, ADSS1, Adenylosuccinate...
Item number: 031666.200
Applications:, Suitable for use in Western Blot, Immunohistochemistry, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Immunohistochemistry: 1:50-100, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are...
| Keywords: | Anti-ADSS1, Anti-AdSS 1, Anti-ADSSL1, Anti-AMPSase 1, EC=6.3.4.4, Anti-IMP--aspartate ligase 1, Anti-M-type... |
| Application: | ELISA, IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
865.00€
*
Anti-PURA1
Item number: ELK-ES13857.100
This gene encodes a member of the adenylosuccinate synthase family of proteins. The encoded muscle-specific enzyme plays a role in the purine nucleotide cycle by catalyzing the first step in the conversion of inosine monophosphate (IMP) to adenosine monophosphate (AMP). Mutations in this gene may cause adolescent...
| Keywords: | Anti-AdSSL1, Anti-AdSS 1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB, IHC |
| Host: | Rabbit |
| Species reactivity: | human, mouse |
From 173.00€
*
ADSSL1 (Vector pUC, Accession No. BC047904)
Item number: CSB-CL836641HU.10
Length: 1374 Sequence: atgtcgggga cccgagcctc caacgaccgg ccccccggcg caggcggcgt caagcggggg cggctgcagc aggaggcggc ggcgaccggc tcccgcgtga cggtggtgct gggcgcgcag tggggggacg agggcaaagg caaggtggtg gacctgctgg ccacggacgc cgacatcatc agccgctgcc aggggggcaa caacgccggc cacacggtgg tggtggatgg gaaagagtac gacttccacc tgctgcccag...
| Keywords: | AdSS 1, AdSSL1, AMPSase 1, IMP--aspartate ligase 1, M-type adenylosuccinate synthetase, Adenylosuccinate synthetase-like... |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
508.00€
*
ADSS1 (human), recombinant protein
Item number: ABS-PP-4164.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Adenylosuccinate synthetase isozyme 1, AMPSase 1, AdSS 1, Adenylosuccinate synthetase, basic isozyme, Adenylosuccinate... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 51.5 kD |
From 90.00€
*
ADSS1 PrEST Antigen
Item number: ATA-APrEST95780.100
PrEST Antigen ADSS1, Gene description: adenylosuccinate synthase 1, Alternative Gene Names: ADSSL1, FLJ38602, Antigen sequence: DILDVLGEVKVGVSYKLNGKRIPYFPANQEMLQKVEVEYETLPGWKADTTGARRWEDLPPQAQNYIRFVENHVGVAVKWVGVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of...
| Keywords: | AdSSL1, AdSS 1, AMPSase 1, IMP--aspartate ligase 1, Adenylosuccinate synthetase-like 1, M-type adenylosuccinate... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Anti-ADSS1
Item number: ABS-KC-33820.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-ADSS1
Item number: ABS-KC-34418.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-ADSS1
Item number: ABS-KC-35080.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | WB |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-ADSS1
Item number: ABS-KC-34953.100
Protein function: Component of the purine nucleotide cycle (PNC), which interconverts IMP and AMP to regulate the nucleotide levels in various tissues, and which contributes to glycolysis and ammoniagenesis. Catalyzes the first committed step in the biosynthesis of AMP from IMP. [The UniProt Consortium]
| Keywords: | Anti-AdSS 1, Anti-AdSSL1, Anti-AMPSase 1, Anti-IMP--aspartate ligase 1, Anti-Adenylosuccinate synthetase-like 1,... |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*