8 products were found matching "GeneID 121006"!
No results were found for the filter!
Anti-FAM186A
Item number: ATA-HPA047128.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 37% and to rat: 27%
| Keywords: | Anti-FAM186A, Anti-Protein FAM186A |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Anti-FAM186A
Item number: ABS-KC-3103.100
| Keywords: | Anti-Protein FAM186A, FAM186A Antibody |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-FAM186A
Item number: ABS-OC-501.100
| Keywords: | Anti-Protein FAM186A, FAM186A Antibody |
| Application: | IHC |
| Host: | Mouse |
| Species reactivity: | human |
From 206.00€
*
Anti-FAM186A
Item number: ATA-HPA064735.100
Polyclonal Antibody against Human FAM186A, Gene description: family with sequence similarity 186 member A, Alternative Gene Names: LOC121006, Validated applications: ICC, Uniprot ID: A6NE01, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 39% Rat gene...
| Keywords: | Anti-FAM186A, Anti-Protein FAM186A |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
FAM186A (human), recombinant protein
Item number: ABS-PP-9086-L.100
| Keywords: | Protein FAM186A, Recombinant Human FAM186A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 48.5 kD |
From 115.00€
*
FAM186A PrEST Antigen
Item number: ATA-APrEST84839.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | FAM186A, Protein FAM186A |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
FAM186A (human), recombinant protein
Item number: ABS-PP-9086.100
| Keywords: | Protein FAM186A, Recombinant Human FAM186A Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 48.5 kD |
From 90.00€
*
FAM186A PrEST Antigen
Item number: ATA-APrEST96004.100
PrEST Antigen FAM186A, Gene description: family with sequence similarity 186 member A, Alternative Gene Names: LOC121006, Antigen sequence: DFKVAQVPFTTKKFQMSEVSDTSEETQILRDTFAIESFRTFQSHFTKYRTPVYQTPYTDERALLTLMKPTTSPSSLTTLLRT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene...
| Keywords: | FAM186A, Protein FAM186A |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*