10 products were found matching "GeneID 119032"!

Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. [The UniProt Consortium] Buffer: 40%...

Polyclonal Antibody against Human BORCS7, Gene description: BLOC-1 related complex subunit 7, Alternative Gene Names: C10orf32, FLJ40752, Validated applications: ICC, Uniprot ID: Q96B45, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: As part of the BORC...

Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. [The UniProt Consortium] Buffer: PBS and...

Protein function: As part of the BORC complex may play a role in lysosomes movement and localization at the cell periphery. Associated with the cytosolic face of lysosomes, the BORC complex may recruit ARL8B and couple lysosomes to microtubule plus-end-directed kinesin motor. [The UniProt Consortium]

Length: 318 Sequence: atggcgactg gaacgccaga gtctcaagcg cggttcggtc agtccgtgaa ggggcttctc acggagaagg tgaccacctg tggtactgac gtaatcgcgc tcaccaagca ggtgctgaaa ggctcccgga gctccgagct gctaggtcag gcagctcgaa acatggtact ccaggaagat gccatcttgc actcagaaga tagtttaagg aagatggcaa taataacaac acatcttcaa taccagcaag aagctattca...

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human

Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: BORCS7. Antigen Species: Human

PrEST Antigen BORCS7, Gene description: BLOC-1 related complex subunit 7, Alternative Gene Names: C10orf32, FLJ40752, Antigen sequence: ARNMVLQEDAILHSEDSLRKMAIITTHLQYQQEAIQKNVEQSSDLQDQLNHLLK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: As part of the BORC complex may...