- Search results for GeneID 117158
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
13 products were found matching "GeneID 117158"!
Close filters
Filter by:
No results were found for the filter!
Item number: CSB-YP846028MO.1
Organism: Mus musculus (Mouse). Source: Yeast. Expression Region: 22-139aa. Protein Length: Full Length of Mature Protein of Isoform C. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: LLINRLPVVD KLPVPLDDII PSFDPLKMLL KTLGISVEHL VTGLKKCVDE LGPEASEAVK KLLVIIICSY FPGRSLCYVN NLPSFVSVLF LPMICAYPRD SKKQTFAFIE...
| Keywords: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2,... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | mouse |
| MW: | 15.2 kD |
From 347.00€
*
Item number: CSB-EP846028MO.1
Organism: Mus musculus (Mouse). Source: E.coli. Expression Region: 22-139aa. Protein Length: Full Length of Mature Protein of Isoform C. Tag Info: N-terminal 6xHis-GST-tagged. Target Protein Sequence: LLINRLPVVD KLPVPLDDII PSFDPLKMLL KTLGISVEHL VTGLKKCVDE LGPEASEAVK KLLVIIICSY FPGRSLCYVN NLPSFVSVLF LPMICAYPRD...
| Keywords: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | mouse |
| MW: | 43.2 kD |
From 292.00€
*
Item number: TGM-TMPH-02891-100ug
Description: SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.
| Keywords: | Scgb3a2, Uteroglobin-related protein 1, Secretoglobin family 3A member 2, Pneumo secretory protein 1 |
| MW: | 43.2 kD |
From 266.00€
*
Item number: TGM-TMPH-02891-10ug
Description: SCGB3A2 Protein, Mouse, Recombinant (GST & His) is expressed in E. coli expression system with N-6xHis-GST tag. The predicted molecular weight is 43.2 kDa and the accession number is Q920H1.
| Keywords: | Secretoglobin family 3A member 2 , Uteroglobin-related protein 1 , Pnsp1 , Scgb3a2 , Ugrp1 , Pneumo secretory protein 1... |
| MW: | 43.2 kD |
From 99.00€
*
Item number: 375219.100
Enzyme and pathway databases. Source: Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~43.2kD, AA Sequence:...
| Keywords: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| MW: | 43,2 |
From 690.00€
*
Item number: 375220.100
Source:, Recombinant protein corresponding to aa22-139 from mouse Scgb3a2, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~15.2kD, AA Sequence: LLINRLPVVDKLPVPLDDIIPSFDPLKMLLKTLGISVEHLVTGLKKCVDELGPEASEAVKKLLVIIICSYFPGRSLCYVNNLPSFVSVLFLPMICAYPRDSKKQTFAFIERVFEQSKL, Storage and Stability: May be...
| Keywords: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| MW: | 15,2 |
From 692.00€
*
Item number: CSB-EL020819MO.48
Sample Types: serum, plasma, tissue homogenates, cell lysates Detection Range: 9.4 pg/mL-600 pg/mL Sensitivity: 2.35 pg/mL Assay Principle: quantitative Measurement: SandwichAssay Time: 1-5h Sample Volume: 50-100ulDetection Wavelength: 450 nmProtein function: Secreted cytokine-like protein. Binds to the scavenger...
| Keywords: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| Application: | ELISA, Sandwich ELISA |
| Species reactivity: | mouse |
From 581.00€
*
Item number: VMPS-5698
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | Pnsp1, PnSP-1, Scgb3a2, Pneumo secretory protein 1, Uteroglobin-related protein 1, Secretoglobin family 3A member 2 |
| Application: | RNA quantification |
45.00€
*
Item number: G-PACO39234.50
Scgb3a2 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Mouse and for use in ELISA applications. Scgb3a2 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Secreted cytokine-like protein. Binds to the scavenger receptor MARCO. Can also bind to...
| Keywords: | Anti-Pnsp1, Anti-PnSP-1, Anti-Scgb3a2, Anti-Pneumo secretory protein 1, Anti-Uteroglobin-related protein 1,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
313.00€
*
Item number: CSB-PA846028LA01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scgb3a2. Antigen Species: Mouse
| Keywords: | Anti-Pnsp1, Anti-PnSP-1, Anti-Scgb3a2, Anti-Pneumo secretory protein 1, Anti-Uteroglobin-related protein 1,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Item number: CSB-PA846028LB01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scgb3a2. Antigen Species: Mouse
| Keywords: | Anti-Pnsp1, Anti-PnSP-1, Anti-Scgb3a2, Anti-Pneumo secretory protein 1, Anti-Uteroglobin-related protein 1,... |
| Application: | ELISA |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*
Item number: CSB-PA846028LC01MO.100
Host Species: Rabbit. Isotype: IgG. Buffer: Preservative: 0.03% Proclin 300Constituents: 50% Glycerol, 0.01M PBS, PH 7.4. Storage: Upon receipt, store at -20°C or -80°C. Avoid repeated freeze. Purification Method: >95%, Protein G purified. Target Name: Scgb3a2. Antigen Species: Mouse
| Keywords: | Anti-Pnsp1, Anti-PnSP-1, Anti-Scgb3a2, Anti-Pneumo secretory protein 1, Anti-Uteroglobin-related protein 1,... |
| Host: | Rabbit |
| Species reactivity: | mouse |
From 167.00€
*