18 products were found matching "GeneID 11341"!
No results were found for the filter!
Human SCRG1(Scrapie responsive protein 1) ELISA Kit
Item number: G-HUFI03075.96
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
698.00€
*
Anti-SCRG1
Item number: G-PACO35186.50
SCRG1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA, IHC applications. SCRG1 Antibody is a high quality polyclonal antibody for research use only.
| Keywords: | Anti-SCRG1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Application: | ELISA, IHC |
| Host: | Rabbit |
| Species reactivity: | human |
313.00€
*
Anti-SCRG1
Item number: ATA-HPA012882.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 89% and to rat: 86%
| Keywords: | Anti-SCRG1, Anti-ScRG-1, Anti-Scrapie-responsive protein 1, Anti-Scrapie-responsive gene 1 protein |
| Application: | IHC |
| Host: | Rabbit |
| Species reactivity: | human |
From 246.00€
*
Scrapie-responsive protein 1 (SCRG1), human, recombinant
Item number: CSB-YP530448HU.1
Organism: Homo sapiens (Human). Source: Yeast. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 90% as determined by...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | Yeast |
| Origin: | human |
| MW: | 10.9 kD |
From 242.00€
*
Scrapie-responsive protein 1 (SCRG1), human, recombinant
Item number: CSB-EP530448HU.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 90% as determined by...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 24.9 kD |
From 219.00€
*
Scrapie-responsive protein 1 (SCRG1), human, recombinant
Item number: CSB-EP530448HUa0.1
Organism: Homo sapiens (Human). Source: E.coli. Expression Region: 21-98aa. Protein Length: Full Length of Mature Protein. Tag Info: N-terminal 6xHis-tagged. Target Protein Sequence: MPANRLSCYR KILKDHNCHN LPEGVADLTQ IDVNVQDHFW DGKGCEMICY CNFSELLCCP KDVFFGPKIS FVIPCNNQ. Purity: Greater than 85% as determined by...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, Recombinant Human Scrapie-responsive... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.9 kD |
From 219.00€
*
SCRG1 Protein, Human, Recombinant (His & SUMO)
Item number: TGM-TMPH-02064-100ug
Description: SCRG1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
| Keywords: | Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein, SCRG1 |
| MW: | 24.9 kD |
From 187.00€
*
SCRG1 Protein, Human, Recombinant (His & SUMO)
Item number: TGM-TMPH-02064-10ug
Description: SCRG1 Protein, Human, Recombinant (His & SUMO) is expressed in E. coli.
| Keywords: | SCRG1 , Scrapie-responsive gene 1 protein (ScRG-1) , Scrapie-responsive protein 1 |
| MW: | 24.9 kD |
From 71.00€
*
SCRG1, Human stimulator of chondrogenesis 1, Real Time...
Item number: VHPS-8168
Primers are provided as a 40 µl solution containing both primers at a final concentration of 50 µM in 10 mM Tris-HCl (pH 7.5), 0.1 mM EDTA. Dilute with water as needed prior to use. This amount is sufficient for 1000 x 20µl PCR reactions assuming a final primer concentration of 0.1 µM. Add cDNA template....
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Application: | RNA quantification |
45.00€
*
SCRG1, Recombinant, Human, aa21-98, His-SUMO-Tag...
Item number: 375225.1
Source:, Recombinant protein corresponding to aa21-98 from human SCRG1, fused to His-SUMO-Tag at N-terminal expressed in E. coli. Molecular Weight: ~24.9kD, AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| MW: | 24,9 |
From 603.00€
*
Scrapie-Responsive Protein 1, Recombinant, Human,...
Item number: 518100.1
Source:, Recombinant protein corresponding to aa21-98 of human Scrapie-Responsive Protein 1, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~12.9kD, AA Sequence: MPANRLSCYRKILKDHNCHNLPEGVADLTQIDVNVQDHFWDGKGCEMICYCNFSELLCCPKDVFFGPKISFVIPCNNQ, Storage and Stability: May be stored at 4°C for...
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 12.9 kD |
From 603.00€
*
SCRG1 PrEST Antigen
Item number: ATA-APrEST72151.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | SCRG1, ScRG-1, Scrapie-responsive protein 1, Scrapie-responsive gene 1 protein |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*