11 products were found matching "GeneID 112858"!

No results were found for the filter!
Anti-TP53RK
Anti-TP53RK

Item number: ATA-HPA015837.100

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
Keywords: Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit...
Application: WB, IHC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-TP53RK
Anti-TP53RK

Item number: ATA-HPA075054.100

Polyclonal Antibody against Human TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Validated applications: IHC, WB, Uniprot ID: Q96S44, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein...
Keywords: Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit...
Application: WB, IHC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
TP53RK (human), recombinant protein
TP53RK (human), recombinant protein

Item number: ABS-PP-12434-L.100

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
Keywords: EKC/KEOPS complex subunit TP53RK, Atypical serine/threonine protein kinase TP53RK, Nori-2, TP53-regulating kinase,...
Expressed in: E.coli
Origin: human
MW: 29 kD
From 115.00€ *
Review
TP53RK protein-GST fusion
TP53RK protein-GST fusion

Item number: 009-001-U16S

Recombinant full-length human TP53RK was expressed by baculovirus in Sf9 insect cells using an N-Terminal Glutathione-S-Transferase fusion protein. The purity was determined to be >80% by densitometry. Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl...
Keywords: TP53RK, Nori-2, C20orf64, EC=3.6.-.-, EC=2.7.11.1, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex...
Application: WB
Expressed in: Human
497.00€ *
Review
Anti-TP53RK, CT (TP53RK, C20orf64, PRPK, TP53-regulating kinase, Nori-2, p53-related protein kinase)
Anti-TP53RK, CT (TP53RK, C20orf64, PRPK, TP53-regulating...

Item number: 043147.200

Protein kinase that phosphorylates 'Ser-15' of p53/TP53 protein and may therefore participate in its activation. Applications: Suitable for use in Western Blot, ELISA, Recommended Dilution: ELISA: 1:1,000, Western Blot: 1:100-500, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid...
Keywords: Anti-TP53RK, Anti-Nori-2, Anti-C20orf64, EC=3.6.-.-, EC=2.7.11.1, Anti-TP53-regulating kinase, Anti-p53-related protein...
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
Anti-PRPK, ID (TP53-regulating Kinase, p53-related Protein Kinase, Nori-2, TP53RK, C20orf64)
Anti-PRPK, ID (TP53-regulating Kinase, p53-related...

Item number: P9120-90.200

Protein kinases are enzymes that transfer a phosphate group from a phosphate donor, generally the g phosphate of ATP, onto an acceptor amino acid in a substrate protein. By this basic mechanism, protein kinases mediate most of the signal transduction in eukaryotic cells, regulating cellular metabolism,...
Keywords: EC=2.7.11.1, Anti-TP53-regulating kinase, Anti-p53-related protein kinase
Application: ELISA, IHC, WB
Host: Rabbit
Species reactivity: human, mouse
865.00€ *
Review
TP53RK PrEST Antigen
TP53RK PrEST Antigen

Item number: ATA-APrEST71455.100

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
Keywords: Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical...
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
Anti-TP53RK
Anti-TP53RK

Item number: G-CAB14952.20

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
Keywords: Anti-Nori-2, Anti-C20orf64, Anti-TP53-regulating kinase, Anti-p53-related protein kinase, Anti-EKC/KEOPS complex subunit...
Application: WB
Host: Rabbit
Species reactivity: human, mouse, rat
103.00€ *
Review
TP53RK (Vector pUC, Accession No. BC009727)
TP53RK (Vector pUC, Accession No. BC009727)

Item number: CSB-CL822302HU.10

Length: 762 Sequence: atggcggcgg ccagagctac tacgccggcc gatggcgagg agcccgcccc ggaggctgag gctctggccg cagcccggga gcggagcagc cgcttcttga gcggcctgga gctggtgaag cagggtgccg aggcgcgcgt gttccgtggc cgcttccagg gccgcgcggc ggtgatcaag caccgcttcc ccaagggcta ccggcacccg gcgctggagg cgcggcttgg cagacggcgg acggtgcagg aggcccgggc...
Keywords: Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical...
Application: Molecular biology, clone
Species reactivity: human
290.00€ *
Review
TP53RK (human), recombinant protein
TP53RK (human), recombinant protein

Item number: ABS-PP-12434.100

Protein function: Component of the EKC/KEOPS complex that is required for the formation of a threonylcarbamoyl group on adenosine at position 37 (t(6)A37) in tRNAs that read codons beginning with adenine (PubMed:22912744, PubMed:27903914). The complex is probably involved in the transfer of the threonylcarbamoyl...
Keywords: EKC/KEOPS complex subunit TP53RK, Atypical serine/threonine protein kinase TP53RK, Nori-2, TP53-regulating kinase,...
Expressed in: E.coli
Origin: human
MW: 29 kD
From 90.00€ *
Review
TP53RK PrEST Antigen
TP53RK PrEST Antigen

Item number: ATA-APrEST95777.100

PrEST Antigen TP53RK, Gene description: TP53 regulating kinase, Alternative Gene Names: BUD32, C20orf64, dJ101A2.2, Nori-2p, prpk, TPRKB, Antigen sequence: FGLSFISALPEDKGVDLYVLEKAFLSTHPNTETVFEAFLKSYSTSSKKARPVLKKLDEVRLRGRKRSMVG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: Nori-2, C20orf64, TP53-regulating kinase, p53-related protein kinase, EKC/KEOPS complex subunit TP53RK, Atypical...
Expressed in: E.coli
Origin: human
264.00€ *
Review