7 products were found matching "GeneID 11036"!
No results were found for the filter!
Anti-GTF2A1L
Item number: ATA-HPA074358.100
Polyclonal Antibody against Human GTF2A1L, Gene description: general transcription factor IIA subunit 1 like, Alternative Gene Names: ALF, Validated applications: ICC, Uniprot ID: Q9UNN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May function as a...
| Keywords: | Anti-ALF, Anti-GTF2A1L, Anti-TFIIA-alpha and beta-like factor, Anti-General transcription factor II A, 1-like factor |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
NEW
Anti-GTF2A1L
Item number: ATA-HPA074358.25
Polyclonal Antibody against Human GTF2A1L, Gene description: general transcription factor IIA subunit 1 like, Alternative Gene Names: ALF, Validated applications: ICC, Uniprot ID: Q9UNN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May function as a...
| Keywords: | Anti-ALF, Anti-GTF2A1L, Anti-TFIIA-alpha and beta-like factor, Anti-General transcription factor II A, 1-like factor |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
GTF2A1L (human), recombinant protein
Item number: ABS-PP-10125-L.100
Protein function: May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription. [The UniProt Consortium]
| Keywords: | TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor, Recombinant Human GTF2A1L Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 30 kD |
From 115.00€
*
Anti-GTF2A1L, CT (GTF2A1L, ALF, GTF2A1LF, TFIIA-alpha and...
Item number: 036352.200
The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general...
| Keywords: | Anti-ALF, Anti-GTF2A1L, Anti-TFIIA-alpha and beta-like factor, Anti-General transcription factor II A, 1-like factor |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | human |
865.00€
*
GTF2A1L (Vector Vector will be determined during the...
Item number: CSB-CL891567HU.10
Length: 1437 Sequence: atggcctgcc tcaacccggt gcctaaactc tacagatctg taattgaaga tgtaattgaa ggagttcgga atctatttgc tgaagaaggt atagaggaac aagttttaaa agacttgaag cagctctggg aaaccaaggt tttgcagtct aaagcaacag aagacttctt cagaaatagc atccaatcac ctctgtttac tcttcagttg ccgcacagct tgcaccaaac attgcaatcg tcaacagcat cattagttat...
| Keywords: | ALF, GTF2A1L, TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor |
| Application: | Molecular biology, clone |
| Species reactivity: | human |
176.00€
*
GTF2A1L (human), recombinant protein
Item number: ABS-PP-10125.100
Protein function: May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription. [The UniProt Consortium]
| Keywords: | TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor, Recombinant Human GTF2A1L Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 30 kD |
From 90.00€
*
GTF2A1L PrEST Antigen
Item number: ATA-APrEST95988.100
PrEST Antigen GTF2A1L, Gene description: general transcription factor IIA subunit 1 like, Alternative Gene Names: ALF, Antigen sequence: GRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May function as a testis...
| Keywords: | ALF, GTF2A1L, TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*