7 products were found matching "GeneID 11036"!

No results were found for the filter!
Anti-GTF2A1L
Anti-GTF2A1L

Item number: ATA-HPA074358.100

Polyclonal Antibody against Human GTF2A1L, Gene description: general transcription factor IIA subunit 1 like, Alternative Gene Names: ALF, Validated applications: ICC, Uniprot ID: Q9UNN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May function as a...
Keywords: Anti-ALF, Anti-GTF2A1L, Anti-TFIIA-alpha and beta-like factor, Anti-General transcription factor II A, 1-like factor
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-GTF2A1L
Anti-GTF2A1L

Item number: ATA-HPA074358.25

Polyclonal Antibody against Human GTF2A1L, Gene description: general transcription factor IIA subunit 1 like, Alternative Gene Names: ALF, Validated applications: ICC, Uniprot ID: Q9UNN4, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May function as a...
Keywords: Anti-ALF, Anti-GTF2A1L, Anti-TFIIA-alpha and beta-like factor, Anti-General transcription factor II A, 1-like factor
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
GTF2A1L (human), recombinant protein
GTF2A1L (human), recombinant protein

Item number: ABS-PP-10125-L.100

Protein function: May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription. [The UniProt Consortium]
Keywords: TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor, Recombinant Human GTF2A1L Protein
Expressed in: E.coli
Origin: human
MW: 30 kD
From 115.00€ *
Review
Anti-GTF2A1L, CT (GTF2A1L, ALF, GTF2A1LF, TFIIA-alpha and beta-like factor, General transcription fa
Anti-GTF2A1L, CT (GTF2A1L, ALF, GTF2A1LF, TFIIA-alpha and...

Item number: 036352.200

The assembly and stability of the RNA polymerase II transcription pre-initiation complex on a eukaryotic core promoter involve the effects of TFIIA on the interaction between TATA-binding protein (TBP) and DNA. This gene encodes a germ cell-specific counterpart of the large (alpha/beta) subunit of general...
Keywords: Anti-ALF, Anti-GTF2A1L, Anti-TFIIA-alpha and beta-like factor, Anti-General transcription factor II A, 1-like factor
Application: ELISA, WB
Host: Rabbit
Species reactivity: human
865.00€ *
Review
GTF2A1L (Vector Vector will be determined during the manufacturing process, either pENTR223.1 or pUC
GTF2A1L (Vector Vector will be determined during the...

Item number: CSB-CL891567HU.10

Length: 1437 Sequence: atggcctgcc tcaacccggt gcctaaactc tacagatctg taattgaaga tgtaattgaa ggagttcgga atctatttgc tgaagaaggt atagaggaac aagttttaaa agacttgaag cagctctggg aaaccaaggt tttgcagtct aaagcaacag aagacttctt cagaaatagc atccaatcac ctctgtttac tcttcagttg ccgcacagct tgcaccaaac attgcaatcg tcaacagcat cattagttat...
Keywords: ALF, GTF2A1L, TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor
Application: Molecular biology, clone
Species reactivity: human
176.00€ *
Review
GTF2A1L (human), recombinant protein
GTF2A1L (human), recombinant protein

Item number: ABS-PP-10125.100

Protein function: May function as a testis specific transcription factor. Binds DNA in conjunction with GTF2A2 and TBP (the TATA-binding protein) and together with GTF2A2, allows mRNA transcription. [The UniProt Consortium]
Keywords: TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor, Recombinant Human GTF2A1L Protein
Expressed in: E.coli
Origin: human
MW: 30 kD
From 90.00€ *
Review
GTF2A1L PrEST Antigen
GTF2A1L PrEST Antigen

Item number: ATA-APrEST95988.100

PrEST Antigen GTF2A1L, Gene description: general transcription factor IIA subunit 1 like, Alternative Gene Names: ALF, Antigen sequence: GRTLPSFTTAELGTSNSSANFTFPGYPIHVPAGVTLQTVSGHLYKVNVPIMVTETS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May function as a testis...
Keywords: ALF, GTF2A1L, TFIIA-alpha and beta-like factor, General transcription factor II A, 1-like factor
Expressed in: E.coli
Origin: human
264.00€ *
Review