- Search results for GeneID 10882
Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
8 products were found matching "GeneID 10882"!
Close filters
Filter by:
No results were found for the filter!
Item number: ATA-HPA071349.100
Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
| Keywords: | Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Item number: ATA-HPA071349.25
Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...
| Keywords: | Anti-C1QRF, Anti-C1QL1, Anti-C1q-related factor, Anti-C1q/TNF-related protein 14, Anti-Complement component 1 Q... |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
Item number: G-AEKE04566.96
The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human C1qL1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human C1qL1. Next,...
| Keywords: | C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14 |
| Application: | ELISA |
| Species reactivity: | rat |
694.00€
*
Item number: ELK-ELK10555.48
May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity) Assay Type: Sandwich. Sensitivity: 1.29 ng/mL. Standard: 200 ng/mL. Detection range: 3.13-200 ng/mL. Sample type: Serum, plasma and other biological fluids.. Assay length: 3.5h....
| Keywords: | C1QL1, C1q-related factor, Complement component 1 Q subcomponent-like 1, C1q and tumor necrosis factor-related protein 14 |
| Application: | ELISA |
| Species reactivity: | human |
From 374.00€
*
Item number: 024337.96
Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) BioAssay(TM) ELISA Kit (Human) is a sandwich enzyme immunoassay for the in vitro quantitative measurement of C1QL1 in human serum, plasma and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.053ng/ml, Storage and Stability:...
| Keywords: | C1QL1, C1QRF, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Application: | ELISA |
| Species reactivity: | human |
1,128.00€
*
Item number: ATA-APrEST95738.100
PrEST Antigen C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Antigen sequence: YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May regulate the number of excitatory synapses...
| Keywords: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
Item number: ABS-PP-25878-L.100
Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
| Keywords: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26 kD |
From 115.00€
*
Item number: ABS-PP-25878.100
Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]
| Keywords: | C1QRF, C1QL1, C1q-related factor, C1q/TNF-related protein 14, Complement component 1 Q subcomponent-like 1, C1q and tumor... |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 26 kD |
From 90.00€
*