7 products were found matching "GeneID 10882"!

Polyclonal Antibody against Human C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Validated applications: ICC, Uniprot ID: O75973, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: May regulate the number...

The test principle applied in this kit is Sandwich enzyme immunoassay. The microtiter plate provided in this kit has been pre-coated with an antibody specific to Human C1qL1. Standards or samples are added to the appropriate microtiter plate wells then with a biotin-conjugated antibody specific to Human C1qL1. Next,...

May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses (By similarity) Assay Type: Sandwich. Sensitivity: 1.29 ng/mL. Standard: 200 ng/mL. Detection range: 3.13-200 ng/mL. Sample type: Serum, plasma and other biological fluids.. Assay length: 3.5h....

Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]

Protein function: May regulate the number of excitatory synapses that are formed on hippocampus neurons. Has no effect on inhibitory synapses. [The UniProt Consortium]

Complement Component 1, Q Subcomponent Like Protein 1 (C1qL1) BioAssay(TM) ELISA Kit (Human) is a sandwich enzyme immunoassay for the in vitro quantitative measurement of C1QL1 in human serum, plasma and other biological fluids. Detection Range: 0.156-10ng/ml, Sensitivity: 0.053ng/ml, Storage and Stability:...

PrEST Antigen C1QL1, Gene description: complement C1q like 1, Alternative Gene Names: C1QRF, C1QTNF14, CRF, CTRP14, Antigen sequence: YHVLMRGGDGTSMWADLCKNGQVRASAIAQDADQNYDYASNSV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May regulate the number of excitatory synapses...