7 products were found matching "GeneID 100170229"!
No results were found for the filter!
Anti-SRRM5
Item number: ATA-HPA047399.100
Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 31% and to rat: 53%
| Keywords: | Anti-SRRM5, Anti-ZNF576, Anti-Serine/arginine repetitive matrix protein 5 |
| Application: | IHC, WB |
| Host: | Rabbit |
| Species reactivity: | human |
From 369.00€
*
Anti-SRRM5
Item number: ATA-HPA052924.100
Polyclonal Antibody against Human SRRM5, Gene description: serine/arginine repetitive matrix 5, Validated applications: ICC, Uniprot ID: B3KS81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene identity: 35%
| Keywords: | Anti-SRRM5, Anti-ZNF576, Anti-Serine/arginine repetitive matrix protein 5 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
491.00€
*
Anti-SRRM5
Item number: ATA-HPA052924.25
Polyclonal Antibody against Human SRRM5, Gene description: serine/arginine repetitive matrix 5, Validated applications: ICC, Uniprot ID: B3KS81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene identity: 35%
| Keywords: | Anti-SRRM5, Anti-ZNF576, Anti-Serine/arginine repetitive matrix protein 5 |
| Application: | ICC |
| Host: | Rabbit |
| Species reactivity: | human |
361.00€
*
SRRM5 PrEST Antigen
Item number: ATA-APrEST84711.100
Buffer: PBS and 1M Urea, pH 7.4.
| Keywords: | SRRM5, ZNF576, Serine/arginine repetitive matrix protein 5 |
| Application: | Control antigen |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SRRM5 (human), recombinant protein
Item number: ABS-PP-12387.100
| Keywords: | Serine/arginine repetitive matrix protein 5, Recombinant Human SRRM5 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 11.5 kD |
From 90.00€
*
SRRM5 PrEST Antigen
Item number: ATA-APrEST95623.100
PrEST Antigen SRRM5, Gene description: serine/arginine repetitive matrix 5, Antigen sequence: SSELAVTPSTAKCQTPTGIPSKEKSDNPSPSSSRKVKSYGQMIIPSREKSYSPTEMSSRVKSYNQASTRSRPQSHSQS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 35% Rat gene identity: 35%
| Keywords: | SRRM5, ZNF576, Serine/arginine repetitive matrix protein 5 |
| Expressed in: | E.coli |
| Origin: | human |
264.00€
*
SRRM5 (human), recombinant protein
Item number: ABS-PP-12387-L.100
| Keywords: | Serine/arginine repetitive matrix protein 5, Recombinant Human SRRM5 Protein |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 11.5 kD |
From 115.00€
*