3 products were found matching "GeneID 100133267"!
No results were found for the filter!
DEFB130, Recombinant, Human, aa23-79, His-Tag...
Item number: 373029.100
Has antibacterial activity. Source: Recombinant protein corresponding to aa23-79 from human DEFB130, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~8.3kD, AA Sequence: GVIPGQKQCIALKGVCRDKLCSTLDDTIGICNEGKKCCRRWWILEPYPTPVPKGKSP, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | DEFB-30, Beta-defensin 30, Beta-defensin 130, Defensin, beta 130, Beta-defensin 130A |
| MW: | 8,3 |
From 692.00€
*
DEFB130B (human), recombinant protein
Item number: ABS-PP-25504-L.100
Protein function: Antimicrobial host-defense peptide. Has an antiplasmodial activity. [The UniProt Consortium]
| Keywords: | Beta-defensin 130B |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 7.5 kD |
From 115.00€
*
DEFB130B (human), recombinant protein
Item number: ABS-PP-25504.100
Protein function: Antimicrobial host-defense peptide. Has an antiplasmodial activity. [The UniProt Consortium]
| Keywords: | Beta-defensin 130B |
| Expressed in: | E.coli |
| Origin: | human |
| MW: | 7.5 kD |
From 90.00€
*
