6 products were found matching "F8UNN7"!
No results were found for the filter!
BlaNDM-1 (NDM-1), partial, Acinetobacter baumannii,...
Item number: CSB-EP761ABS.1
Organism: Acinetobacter baumannii. Source: E.coli. Expression Region: 164-222aa. Protein Length: Partial. Tag Info: N-terminal 6xHis-SUMO-tagged. Target Protein Sequence: AANGWVEPAT APNFGPLKVF YPGPGHTSDN ITVGIDGTDI AFGGCLIKDS KAKSLGNLG. Purity: Greater than 90% as determined by SDS-PAGE. Endotoxin: Not test....
| Keywords: | NDM-1, BlaNDM-1, Beta-lactamase NDM-1, Metallo-beta-lactamase, Metallo-beta-lactamase 1, Class B carbapenemase NDM-1,... |
| Application: | Activity not tested |
| Expressed in: | E.coli |
| Origin: | Acinetobacter baumannii |
| MW: | 22 kD |
From 364.00€
*
BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant...
Item number: TGM-TMPH-00019-100ug
Description: BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant (His & SUMO) is expressed in E. coli with N-terminal 6xHis-SUMO tag. The predicted molecular weight is 22.0 kDa. Accession number: F8UNN7
| Keywords: | blaNDM-1, Metallo-beta-lactamase, NDM-1, Class B carbapenemase NDM-1, Beta-lactamase NDM-1, NDM-1 metallo-beta-lactamase |
| MW: | 22.0 kD |
From 340.00€
*
BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant...
Item number: TGM-TMPH-00019-10ug
Description: BlaNDM-1 Protein, Acinetobacter baumannii, Recombinant (His & SUMO) is expressed in E. coli with N-terminal 6xHis-SUMO tag. The predicted molecular weight is 22.0 kDa. Accession number: F8UNN7
| Keywords: | NDM-1 , blaNDM-1 |
| MW: | 22 kD |
From 122.00€
*
Anti-NDM-1
Item number: CSB-PA07618ZA01ABS.100
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-NDM-1, Anti-BlaNDM-1, Anti-Beta-lactamase NDM-1, Anti-Metallo-beta-lactamase, Anti-Metallo-beta-lactamase 1,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Acinetobacter baumannii |
1,529.00€
*
Ndm-1, Recombinant, Acinetobacter Baumannii, aa164-222,...
Item number: 374386.100
Source:, Recombinant protein corresponding to aa164-222 from acinetobacter baumannii NDM-1, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22kD, AA Sequence: AANGWVEPATAPNFGPLKVFYPGPGHTSDNITVGIDGTDIAFGGCLIKDSKAKSLGNLG, Storage and Stability: May be stored at 4°C for short-term only....
| Keywords: | NDM-1, BlaNDM-1, Beta-lactamase, Beta-lactamase NDM-1, Metallo-beta-lactamase, Metallo-beta-lactamase 1, Class B... |
| MW: | 22 |
From 786.00€
*
Anti-NDM-1
Item number: CSB-PA07618ZA01ABS.2
Make to order. Production time: 70-80 business days. Deliverables: 1. 200 µg antigen (used as positive control), 2. 1 ml pre-immune serum (used as negative control) , 3. Rabbit polyclonal antibody, antigen affinity purified. Quality Guarantee: 1. Antibody purity > 90% confirmed by SDS-PAGE, 2. Antibody titer > 1:...
| Keywords: | Anti-NDM-1, Anti-BlaNDM-1, Anti-Beta-lactamase NDM-1, Anti-Metallo-beta-lactamase, Anti-Metallo-beta-lactamase 1,... |
| Application: | ELISA, WB |
| Host: | Rabbit |
| Species reactivity: | Acinetobacter baumannii |
From 1,529.00€
*