7 products were found matching "B3KS81"!

No results were found for the filter!
Anti-SRRM5
Anti-SRRM5

Item number: ATA-HPA047399.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 31% and to rat: 53%
Keywords: Anti-SRRM5, Anti-ZNF576, Anti-Serine/arginine repetitive matrix protein 5
Application: IHC, WB
Host: Rabbit
Species reactivity: human
From 369.00€ *
Review
Anti-SRRM5
Anti-SRRM5

Item number: ATA-HPA052924.100

Polyclonal Antibody against Human SRRM5, Gene description: serine/arginine repetitive matrix 5, Validated applications: ICC, Uniprot ID: B3KS81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene identity: 35%
Keywords: Anti-SRRM5, Anti-ZNF576, Anti-Serine/arginine repetitive matrix protein 5
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
Anti-SRRM5
Anti-SRRM5

Item number: ATA-HPA052924.25

Polyclonal Antibody against Human SRRM5, Gene description: serine/arginine repetitive matrix 5, Validated applications: ICC, Uniprot ID: B3KS81, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 35% Rat gene identity: 35%
Keywords: Anti-SRRM5, Anti-ZNF576, Anti-Serine/arginine repetitive matrix protein 5
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
SRRM5 PrEST Antigen
SRRM5 PrEST Antigen

Item number: ATA-APrEST84711.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: SRRM5, ZNF576, Serine/arginine repetitive matrix protein 5
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
SRRM5 (human), recombinant protein
SRRM5 (human), recombinant protein

Item number: ABS-PP-12387.100

Keywords: Serine/arginine repetitive matrix protein 5, Recombinant Human SRRM5 Protein
Expressed in: E.coli
Origin: human
MW: 11.5 kD
From 90.00€ *
Review
SRRM5 PrEST Antigen
SRRM5 PrEST Antigen

Item number: ATA-APrEST95623.100

PrEST Antigen SRRM5, Gene description: serine/arginine repetitive matrix 5, Antigen sequence: SSELAVTPSTAKCQTPTGIPSKEKSDNPSPSSSRKVKSYGQMIIPSREKSYSPTEMSSRVKSYNQASTRSRPQSHSQS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 35% Rat gene identity: 35%
Keywords: SRRM5, ZNF576, Serine/arginine repetitive matrix protein 5
Expressed in: E.coli
Origin: human
264.00€ *
Review
SRRM5 (human), recombinant protein
SRRM5 (human), recombinant protein

Item number: ABS-PP-12387-L.100

Keywords: Serine/arginine repetitive matrix protein 5, Recombinant Human SRRM5 Protein
Expressed in: E.coli
Origin: human
MW: 11.5 kD
From 115.00€ *
Review