7 products were found matching "A6NP61"!

No results were found for the filter!
Anti-ZAR1L
Anti-ZAR1L

Item number: ATA-HPA041319.100

Buffer: 40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. Highest antigen sequence identity to mouse: 35% and to rat: 30%
Keywords: Anti-ZAR1L, Anti-ZAR1-like protein
Application: IHC
Host: Rabbit
Species reactivity: human
From 246.00€ *
Review
Anti-ZAR1L
Anti-ZAR1L

Item number: ATA-HPA039540.100

Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
Keywords: Anti-ZAR1L, Anti-ZAR1-like protein
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
NEW
Anti-ZAR1L
Anti-ZAR1L

Item number: ATA-HPA039540.25

Polyclonal Antibody against Human ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Validated applications: ICC, Uniprot ID: A6NP61, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Mouse gene identity: 44% Rat gene identity: 44%
Keywords: Anti-ZAR1L, Anti-ZAR1-like protein
Application: ICC
Host: Rabbit
Species reactivity: human
361.00€ *
Review
ZAR1L (human), recombinant protein
ZAR1L (human), recombinant protein

Item number: ABS-PP-9500-L.100

Keywords: Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein
Expressed in: E.coli
Origin: human
MW: 16 kD
From 115.00€ *
Review
ZAR1L PrEST Antigen
ZAR1L PrEST Antigen

Item number: ATA-APrEST81392.100

Buffer: PBS and 1M Urea, pH 7.4.
Keywords: ZAR1L, ZAR1-like protein
Application: Control antigen
Expressed in: E.coli
Origin: human
264.00€ *
Review
ZAR1L (human), recombinant protein
ZAR1L (human), recombinant protein

Item number: ABS-PP-9500.100

Keywords: Protein ZAR1-like, Zygote arrest protein 1-like, Recombinant Human ZAR1L Protein
Expressed in: E.coli
Origin: human
MW: 16 kD
From 90.00€ *
Review
ZAR1L PrEST Antigen
ZAR1L PrEST Antigen

Item number: ATA-APrEST95928.100

PrEST Antigen ZAR1L, Gene description: zygote arrest 1 like, Alternative Gene Names: Z3CXXC7, Antigen sequence: FVRVPYGLYQGYGSTVPLGQPGLSGHKQPDWRQNMGPPTFLARPGLLVPANAPDYCIDPYKRAQLKAILSQMNPSLSPRLCKPNTK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 44% Rat gene identity:...
Keywords: ZAR1L, ZAR1-like protein
Expressed in: E.coli
Origin: human
264.00€ *
Review