2 products were found matching "A0A1B0GTD5"!

No results were found for the filter!
Anti-TEX49
Anti-TEX49

Item number: ATA-HPA066635.100

Polyclonal Antibody against Human TEX49, Gene description: testis expressed 49, Alternative Gene Names: LINC00935, Validated applications: ICC, Uniprot ID: A0A1B0GTD5, Storage: Store at +4°C for short term storage. Long time storage is recommended at -20°C. Protein function: Microtubule inner protein (MIP) part of...
Keywords: Anti-Testis-expressed protein 49, Anti-Sperm microtubule inner protein 11
Application: ICC
Host: Rabbit
Species reactivity: human
491.00€ *
Review
TEX49 PrEST Antigen
TEX49 PrEST Antigen

Item number: ATA-APrEST95695.100

PrEST Antigen TEX49, Gene description: testis expressed 49, Alternative Gene Names: LINC00935, Antigen sequence: KTFPNQVFRIPLTDAQNFSFWWSHDPGVRPEETMPWIRSPRHCLIKSAMTRFMDHSILNDRTFSLY, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Microtubule inner protein (MIP) part of the...
Keywords: Testis-expressed protein 49, Sperm microtubule inner protein 11
Expressed in: E.coli
Origin: human
264.00€ *
Review