ZP3 PrEST Antigen

ZP3 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96177.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ZP3, Gene description: zona pellucida glycoprotein 3, Alternative Gene Names:... more
Product information "ZP3 PrEST Antigen"
PrEST Antigen ZP3, Gene description: zona pellucida glycoprotein 3, Alternative Gene Names: ZP3-372, ZP3-424, ZP3A, ZP3B, ZPC, Antigen sequence: CLVDGLTDASSAFKVPRPGPDTLQFTVDVFHFANDSRNMIYITCHLKVTLAEQDPDELNKACSFSKPSNSWFPVEG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the zona pellucida, an extracellular matrix surrounding oocytes which mediates sperm binding, induction of the acrosome reaction and prevents post-fertilization polyspermy. The zona pellucida is composed of 3 to 4 glycoproteins, ZP1, ZP2, ZP3, and ZP4. ZP3 is essential for sperm binding and zona matrix formation. [The UniProt Consortium] Mouse gene identity: 75% Rat gene identity: 75%
Keywords: ZP3, ZP3A
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96177

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZP3 PrEST Antigen"
Write a review
or to review a product.
Viewed