ZNF496 PrEST Antigen

ZNF496 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95561.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ZNF496, Gene description: zinc finger protein 496, Alternative Gene Names:... more
Product information "ZNF496 PrEST Antigen"
PrEST Antigen ZNF496, Gene description: zinc finger protein 496, Alternative Gene Names: MGC15548, ZKSCAN17, ZSCAN49, Antigen sequence: SYVCPNCGKIFRWRVNFIRHLRSRREQEKPHECSVCGELFSDSEDLDGHLESHEAQKPYRCGACGKSFRLNSHLLSHRRIHLQPDRLQPVEKREQAASEDADKGPKEPLENGKAKLSFQCCECGKAFQRHDHLARHRSHFHLKD, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: DNA-binding transcription factor that can both act as an activator and a repressor. [The UniProt Consortium] Mouse gene identity: 78% Rat gene identity: 78%
Keywords: ZNF496, ZKSCAN17, Zinc finger protein 496, Zinc finger protein with KRAB and SCAN domains 17
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95561

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZNF496 PrEST Antigen"
Write a review
or to review a product.
Viewed