ZNF474 PrEST Antigen

ZNF474 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95690.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ZNF474, Gene description: zinc finger protein 474, Alternative Gene Names:... more
Product information "ZNF474 PrEST Antigen"
PrEST Antigen ZNF474, Gene description: zinc finger protein 474, Alternative Gene Names: 4933409D10Rik, FLJ32921, Antigen sequence: GSQSIAIHEPQCLQKWHIENSKLPKHLRRPEPSKPQSLSSSGSYSLQATNEAAFQSAQAQLLPCESCGRTFLPDHLLVHHRSCKPKGE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 82% Rat gene identity: 82%
Keywords: TSZFP, ZNF474, Zinc finger protein 474, Testis-specific zinc finger protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95690

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q6S9Z5 | Matching products
Gene ID : GeneID 133923 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZNF474 PrEST Antigen"
Write a review
or to review a product.
Viewed