ZFP91 PrEST Antigen

ZFP91 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95746.100 100 µl

7 - 10 business days*

265.00€
 
PrEST Antigen ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase,... more
Product information "ZFP91 PrEST Antigen"
PrEST Antigen ZFP91, Gene description: ZFP91 zinc finger protein, atypical E3 ubiquitin ligase, Alternative Gene Names: PZF, ZNF757, Antigen sequence: YCSGTERVSLMADGKIFVGSGSSGGTEGLVMNSDILGATTEVLIEDSDSAGP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Atypical E3 ubiquitin-protein ligase that mediates 'Lys-63'- linked ubiquitination of MAP3K14/NIK, leading to stabilize and activate MAP3K14/NIK. It thereby acts as an activator of the non-canonical NF- kappa-B2/NFKB2 pathway. May also play an important role in cell proliferation and/or anti-apoptosis. [The UniProt Consortium] Mouse gene identity: 96% Rat gene identity: 96%
Keywords: ZFP91, FKSG11, ZNF757, Zfp-91, EC=2.3.2.27, Zinc finger protein 757, Zinc finger protein 91 homolog, E3 ubiquitin-protein ligase ZFP91, RING-type E3 ubiquitin transferase ZFP91
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95746

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q96JP5 | Matching products
Gene ID : GeneID 80829 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ZFP91 PrEST Antigen"
Write a review
or to review a product.
Viewed