UHRF1, Recombinant, Human, aa108-286, His-Tag (Ubiquitin-Like With PHD And Ring Finger Domains, RING

UHRF1, Recombinant, Human, aa108-286, His-Tag (Ubiquitin-Like With PHD And Ring Finger Domains, RING
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298489.100 100 µg - -

3 - 19 business days*

1,206.00€
 
Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and... more
Product information "UHRF1, Recombinant, Human, aa108-286, His-Tag (Ubiquitin-Like With PHD And Ring Finger Domains, RING"
Multidomain protein that acts as a key epigenetic regulator by bridging DNA methylation and chromatin modification. Specifically recognizes and binds hemimethylated DNA at replication forks via its YDG domain and recruits DNMT1 methyltransferase to ensure faithful propagation of the DNA methylation patterns through DNA replication. In addition to its role in maintenance of DNA methylation, it also plays a key role in chromatin modification. The protein binds to specific DNA sequences, and recruits a histone deacetylase to regulate gene expression. Has E3 ubiquitin-protein ligase activity by mediating the ubiquitination of target proteins such as histone H3 and PML. May be involved in DNA repair. Its expression peaks at late G1 phase and continues during G2 and M phases of the cell cycle. It plays a major role in the G1/S transition by regulating topoisomerase IIalpha and retinoblastoma gene expression, and functions in the p53-dependent DNA damage checkpoint. Also localizes to euchromatic regions where it negatively regulates transcription possibly by impacting DNA methylation and histone modifications. Source: Recombinant protein corresponding to aa108-286 from the tandem tudor domain region of human UHRF1, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~21.6kD, AA Sequence: MHHHHHHSTHGEAAAETDSRPADEDMWDETELGLYKVNEYVDARDTNMGAWFEAQ, VVRVTRKAPSRDEPCSSTSRPALEEDVIYHVKYDDYPENGVVQMNSRDVRARARTIIK, WQDLEVGQVVMLNYNPDNPKERGFWYDAEISRKRETRTARELYANVVLGDDSLNDC, RIIFVDEVFKIERPGEG, Applications: Suitable for use in protein binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: hNp95, UHRF1, HuNp95, hUHRF1, ICBP90, EC=2.3.2.27, Nuclear protein 95, RING finger protein 106, Transcription factor ICBP90, Nuclear zinc finger protein Np95, E3 ubiquitin-protein ligase UHRF1, RING-type E3 ubiquitin transferase UHRF1
Supplier: United States Biological
Supplier-Nr: 298489

Properties

Conjugate: No
MW: 21,6
Format: Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "UHRF1, Recombinant, Human, aa108-286, His-Tag (Ubiquitin-Like With PHD And Ring Finger Domains, RING"
Write a review
or to review a product.
Viewed