UBA5 PrEST Antigen

UBA5 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96098.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen UBA5, Gene description: ubiquitin like modifier activating enzyme 5, Alternative... more
Product information "UBA5 PrEST Antigen"
PrEST Antigen UBA5, Gene description: ubiquitin like modifier activating enzyme 5, Alternative Gene Names: FLJ23251, UBE1DC1, Antigen sequence: LERELAQERSLQVPRSGDGGGGRVRIEKMSSEVVDSNPYSRLMALKRMGIVSDYEK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: E1-like enzyme which specifically catalyzes the first step in ufmylation (PubMed:15071506, PubMed:18442052, PubMed:25219498, PubMed:20368332, PubMed:27653677, PubMed:26929408, PubMed:27545674, PubMed:30412706, PubMed:27545681). Activates UFM1 by first adenylating its C-terminal glycine residue with ATP, and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding a UFM1- E1 thioester and free AMP (PubMed:20368332, PubMed:27653677, PubMed:26929408, PubMed:30412706). Activates UFM1 via a trans-binding mechanism, in which UFM1 interacts with distinct sites in both subunits of the UBA5 homodimer (PubMed:27653677). Trans-binding also promotes stabilization of the UBA5 homodimer, and enhances ATP-binding (PubMed:29295865). Transfer of UFM1 from UBA5 to the E2-like enzyme UFC1 also takes place using a trans mechanism (PubMed:27653677). Ufmylation is involved in reticulophagy (also called ER-phagy) induced in response to endoplasmic reticulum stress (PubMed:32160526). Ufmylation is essential for erythroid differentiation of both megakaryocytes and erythrocytes. [The UniProt Consortium] Mouse gene identity: 70% Rat gene identity: 70%
Keywords: ThiFP1, UFM1-activating enzyme, Ubiquitin-activating enzyme 5, Ubiquitin-like modifier-activating enzyme 5, Ubiquitin-activating enzyme E1 domain-containing protein 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96098

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "UBA5 PrEST Antigen"
Write a review
or to review a product.
Viewed