Transforming Growth Factor beta Induced, Recombinant, Human (BIGH3, TGFBI, ig-h3)

BIGH3, also known as TGFBI and ig-h3, is an extracellular matrix protein induced by transforming growth factor(TGF)-beta 1. BIGH3 protein is involved in cell growth, cell differentiation, wound healing and cell adhesion. In addition, some missense mutations of BIGH3 were identified in families affected with human autosomal dominant corneal dystrophies. BIGH3 gene encodes for a 683 amino-acid protein containing an RGD motif and four internal repeated domains which have highly conserved sequences founded in several species (Fasciclin domain). Recombinant human BIGH3 protein (fourth FAS domain) was expressed in E. coli and purified by using conventional chromatography techniques. Molecular Weight: 14.5kD (135 amino acids, residues 502-636), Sequence: MGTVMDVLKGDNRFSMLVAAIQSAGLTETLNREGVYTVF, APTNEAFRALPPRERSRLLGDAKELANILKYHIGDEILV , SGGIGALVRLKSLQGDKLEVSLKNNVVSVNKEPVAEPDI , MATNGVVHVITNVLQPPA, Storage and Stability: May be stored at 4°C for short-term only. For long-term storage, store at -20°C. Aliquots are stable for at least 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.