TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TB

TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TB
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298478.100 100 µg - -

3 - 19 business days*

960.00€
 
This locus is intronless, and apparently arose in the primate lineage from retrotransposition of... more
Product information "TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TB"
This locus is intronless, and apparently arose in the primate lineage from retrotransposition of the transcript from the multi-exon TAF1 locus on the X chromosome. The gene is expressed in male germ cells, and the product has been shown to function interchangeably with the TAF1 product. [provided by RefSeq, Aug 2009]. Source: Recombinant protein corresponding to aa1517-1649 from human TAF1L, fused to GST-tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.3kD, AA Sequence: MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYI, DGDVKLTQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLK, VDFLSKLPEMLKMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLV, CFKKRIEAIPQIDKYLKSSKYIAWPLQGWQATFGGGDHPPKSDLEVLFQGPLGSLLDDD, DQVAFSFILDNIVTQKMMAVPDSWPFHHPVNKKFVPDYYKMIVNPVDLETIRKNISKHK, YQSRESFLDDVNLILANSVKYNGPESQYTKTAQEIVNICYQTITEYDEHLTQLEKDICTA, KEAALEEAE, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: TAF1L, TAF(II)210, TBP-associated factor 1-like, TBP-associated factor 210 kDa, Transcription initiation factor TFIID subunit 1-like, Transcription initiation factor TFIID 210 kDa subunit
Supplier: United States Biological
Supplier-Nr: 298478

Properties

Conjugate: No
MW: 42,3
Format: Highly Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "TAF1L, Recombinant, Human, aa1517-1649, GST-tag (TAF1 RNA Polymerase II, TAT Box Binding Protein (TB"
Write a review
or to review a product.
Viewed