SYP PrEST Antigen

SYP PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96051.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen SYP, Gene description: synaptophysin, Alternative Gene Names: MRX96, Antigen... more
Product information "SYP PrEST Antigen"
PrEST Antigen SYP, Gene description: synaptophysin, Alternative Gene Names: MRX96, Antigen sequence: GPQDSYGPQGGYQPDYGQPAGSGGSGYGPQGDYGQQGYGPQGAPTSFSNQM, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Possibly involved in structural functions as organizing other membrane components or in targeting the vesicles to the plasma membrane. Involved in the regulation of short-term and long-term synaptic plasticity. [The UniProt Consortium] Mouse gene identity: 92% Rat gene identity: 92%
Keywords: SYP, Synaptophysin, Major synaptic vesicle protein p38
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96051

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : P08247 | Matching products
Gene ID : GeneID 6855 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "SYP PrEST Antigen"
Write a review
or to review a product.
Viewed