SUMO4, Recombinant, Human, aa1-95, GST-Tag (Small Ubiquitin-related Modifier 4)

Small ubiquitin-like protein 4. Source: Recombinant protein corresponding to aa1-95 from human SUMO4, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.7kD, AA Sequence: MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.