ST6GALNAC6 PrEST Antigen

ST6GALNAC6 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95697.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ST6GALNAC6, Gene description: ST6 N-acetylgalactosaminide... more
Product information "ST6GALNAC6 PrEST Antigen"
PrEST Antigen ST6GALNAC6, Gene description: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, Alternative Gene Names: SIAT7F, ST6GALNACVI, Antigen sequence: SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transfers the sialyl group (N-acetyl-alpha-neuraminyl or NeuAc) from CMP-NeuAc onto glycoproteins and glycolipids, forming an alpha-2,6-linkage. Produces branched type disialyl structures by transfer of a sialyl group onto the GalNAc or GlcNAc residue inside backbone core chains having a terminal sialic acid with an alpha-2,3- linkage on Gal. ST6GalNAcVI prefers glycolipids to glycoproteins, predominantly catalyzing the biosynthesis of ganglioside GD1alpha from GM1b (PubMed:12668675, PubMed:17123352). Besides GMb1, MSGG and other glycolipids, it shows activity towards sialyl Lc4Cer generating disialyl Lc4Cer, which can lead to the synthesis of disialyl Lewis a (Le(a)), suggested to be a cancer-associated antigen (PubMed:12668675). Also has activity toward GD1a and GT1b, and can generate DSGG (disialylgalactosylgloboside) from MSGG (monosialylgalactosylgloboside). [The UniProt Consortium] Mouse gene identity: 86% Rat gene identity: 86%
Keywords: SIAT7F, SIAT7-F, ST6GALNAC6, ST6GalNAcVI, ST6GalNAc VI, hST6GalNAc VI, Sialyltransferase 7F, GalNAc alpha-2,6-sialyltransferase VI, Alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 6
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95697

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ST6GALNAC6 PrEST Antigen"
Write a review
or to review a product.
Viewed