SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)

SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370795.20 20 µg - -

3 - 19 business days*

786.00€
370795.100 100 µg - -

3 - 19 business days*

1,096.00€
 
Not known, suppressor of MIF2 mutations.||Source:|Recombinant protein corresponding to aa2-98... more
Product information "SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)"
Not known, suppressor of MIF2 mutations. Source: Recombinant protein corresponding to aa2-98 from Saccharomyces cerevisiae SMT3, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~27.12kD, AA Sequence: SDSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRRLMEAFAKRQGKEMDSLRFLYDGIRIQADQTPEDLDMEDNDIIEAHREQIGG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: SMT3, YDR510W, D9719.15, Ubiquitin-like protein SMT3
Supplier: United States Biological
Supplier-Nr: 370795

Properties

Conjugate: No
MW: 27,12
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "SMT3, Recombinant, Saccharomyces Cerevisiae, aa2-98, His-Tag (Ubiquitin-like Protein SMT3)"
Write a review
or to review a product.
Viewed