SLC20A1 PrEST Antigen

SLC20A1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96161.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen SLC20A1, Gene description: solute carrier family 20 member 1, Alternative Gene... more
Product information "SLC20A1 PrEST Antigen"
PrEST Antigen SLC20A1, Gene description: solute carrier family 20 member 1, Alternative Gene Names: Glvr-1, GLVR1, PiT-1, PiT1, Antigen sequence: YTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Sodium-phosphate symporter which plays a fundamental housekeeping role in phosphate transport, such as absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. May play a role in extracellular matrix and cartilage calcification as well as in vascular calcification. [The UniProt Consortium] Mouse gene identity: 94% Rat gene identity: 94%
Keywords: GLVR1, PiT-1, GLVR-1, SLC20A1, Phosphate transporter 1, Solute carrier family 20 member 1, Leukemia virus receptor 1 homolog, Gibbon ape leukemia virus receptor 1, Sodium-dependent phosphate transporter 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96161

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "SLC20A1 PrEST Antigen"
Write a review
or to review a product.
Viewed