RPL34 PrEST Antigen

RPL34 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95702.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen RPL34, Gene description: ribosomal protein L34, Alternative Gene Names: L34,... more
Product information "RPL34 PrEST Antigen"
PrEST Antigen RPL34, Gene description: ribosomal protein L34, Alternative Gene Names: L34, Antigen sequence: GVRAVRPKVLMRLSKTKKHVSRAYGGSMCAKC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the large ribosomal subunit. [The UniProt Consortium] Mouse gene identity: 97% Rat gene identity: 97%
Keywords: RPL34, 60S ribosomal protein L34, Large ribosomal subunit protein eL34
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95702

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RPL34 PrEST Antigen"
Write a review
or to review a product.
Viewed