RNF7, Recombinant, Human, aa2-113, His-Tag (RING-box Protein 2)

RNF7, Recombinant, Human, aa2-113, His-Tag (RING-box Protein 2)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375079.20 20 µg - -

3 - 19 business days*

557.00€
375079.100 100 µg - -

3 - 19 business days*

810.00€
 
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which... more
Product information "RNF7, Recombinant, Human, aa2-113, His-Tag (RING-box Protein 2)"
Probable component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins involved in cell cycle progression, signal transduction and transcription. Through the RING-type zinc finger, seems to recruit the E2 ubiquitination enzyme to the complex and brings it into close proximity to the substrate. Promotes the neddylation of CUL5 via its interaction with UBE2F. May play a role in protecting cells from apoptosis induced by redox agents. Source: Recombinant protein corresponding to aa2-113 from human RNF7, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~14.5kD, AA Sequence: ADVEDGEETCALASHSGSSGSKSGGDKMFSLKKWNAVAMWSWDVECDTCAICRVQVMDACLRCQAENKQEDCVVVWGECNHSFHNCCMSLWVKQNNRCPLCQQDWVVQRIGK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: RBX2, RNF7, Rbx2, CKBBP1, RING-box protein 2, RING finger protein 7, Regulator of cullins 2, CKII beta-binding protein 1, Sensitive to apoptosis gene protein
Supplier: United States Biological
Supplier-Nr: 375079

Properties

Conjugate: No
MW: 14,5
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RNF7, Recombinant, Human, aa2-113, His-Tag (RING-box Protein 2)"
Write a review
or to review a product.
Viewed