RCN1, Recombinant, Human, aa31-331, His-Tag (Reticulocalbin-1)

RCN1, Recombinant, Human, aa31-331, His-Tag (Reticulocalbin-1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
375013.20 20 µg - -

3 - 19 business days*

557.00€
375013.100 100 µg - -

3 - 19 business days*

810.00€
 
May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER... more
Product information "RCN1, Recombinant, Human, aa31-331, His-Tag (Reticulocalbin-1)"
May regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment. Source: Recombinant protein corresponding to aa31-331 from human RCN1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~37.7kD, AA Sequence: PTVRKERVVRPDSELGERPPEDNQSFQYDHEAFLGKEDSKTFDQLTPDESKERLGKIVDRIDNDGDGFVTTEELKTWIKRVQKRYIFDNVAKVWKDYDRDKDDKISWEEYKQATYGYYLGNPAEFHDSSDHHTFKKMLPRDERRFKAADLNGDLTATREEFTAFLHPEEFEHMKEIVVLETLEDIDKNGDGFVDQDEYIADMFSHEENGPEPDWVLSEREQFNEFRDLNKDGKLDKDEIRHWILPQDYDHAQAEARHLVYESDKNKDEKLTKEEILENWNMFVGSQATNYGEDLTKNHDEL, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: RCN, RCN1, Reticulocalbin-1
Supplier: United States Biological
Supplier-Nr: 375013

Properties

Conjugate: No
MW: 37,7
Format: Purified

Database Information

UniProt ID : Q15293 | Matching products
Gene ID : GeneID 5954 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RCN1, Recombinant, Human, aa31-331, His-Tag (Reticulocalbin-1)"
Write a review
or to review a product.
Viewed