RALBP1 PrEST Antigen

RALBP1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95891.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen RALBP1, Gene description: ralA binding protein 1, Alternative Gene Names: RIP,... more
Product information "RALBP1 PrEST Antigen"
PrEST Antigen RALBP1, Gene description: ralA binding protein 1, Alternative Gene Names: RIP, RIP1, RLIP76, Antigen sequence: PPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Can activate specifically hydrolysis of GTP bound to RAC1 and CDC42, but not RALA. Mediates ATP-dependent transport of S-(2,4- dinitrophenyl)-glutathione (DNP-SG) and doxorubicin (DOX) and is the major ATP-dependent transporter of glutathione conjugates of electrophiles (GS-E) and DOX in erythrocytes. Can catalyze transport of glutathione conjugates and xenobiotics, and may contribute to the multidrug resistance phenomenon. Serves as a scaffold protein that brings together proteins forming an endocytotic complex during interphase and also with CDK1 to switch off endocytosis, One of its substrates would be EPN1/Epsin. [The UniProt Consortium] Mouse gene identity: 95% Rat gene identity: 95%
Keywords: RLIP1, RalBP1, RALBP1, DNP-SG ATPase, RalA-binding protein 1, Ral-interacting protein 1, 76 kDa Ral-interacting protein, Dinitrophenyl S-glutathione ATPase
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95891

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "RALBP1 PrEST Antigen"
Write a review
or to review a product.
Viewed