PSTPIP1 PrEST Antigen

PSTPIP1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95974.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen PSTPIP1, Gene description: proline-serine-threonine phosphatase interacting protein... more
Product information "PSTPIP1 PrEST Antigen"
PrEST Antigen PSTPIP1, Gene description: proline-serine-threonine phosphatase interacting protein 1, Alternative Gene Names: CD2BP1, CD2BP1L, CD2BP1S, H-PIP, PAPAS, PSTPIP, Antigen sequence: LTILRNALWVHSNQLSMQCVKDDELYEEVRLTLEGCSIDADIDSFIQAKSTGTEPPAPVPYQNYYDREVTPLTSSPGIQPSC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in regulation of the actin cytoskeleton. May regulate WAS actin-bundling activity. Bridges the interaction between ABL1 and PTPN18 leading to ABL1 dephosphorylation. May play a role as a scaffold protein between PTPN12 and WAS and allow PTPN12 to dephosphorylate WAS. Has the potential to physically couple CD2 and CD2AP to WAS. Acts downstream of CD2 and CD2AP to recruit WAS to the T- cell:APC contact site so as to promote the actin polymerization required for synapse induction during T-cell activation. Down-regulates CD2-stimulated adhesion through the coupling of PTPN12 to CD2. Also has a role in innate immunity and the inflammatory response. Recruited to inflammasomes by MEFV. Induces formation of pyroptosomes, large supramolecular structures composed of oligomerized PYCARD dimers which form prior to inflammatory apoptosis. Binding to MEFV allows MEFV to bind to PYCARD and facilitates pyroptosome formation. Regulates endocytosis and cell migration in neutrophils. [The UniProt Consortium] Mouse gene identity: 84% Rat gene identity: 84%
Keywords: H-PIP, CD2BP1, PSTPIP1, CD2-binding protein 1, PEST phosphatase-interacting protein 1, Proline-serine-threonine phosphatase-interacting protein 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95974

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PSTPIP1 PrEST Antigen"
Write a review
or to review a product.
Viewed