Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)

Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298243.100 100 µg - -

3 - 19 business days*

449.00€
298243.1 1 mg - -

3 - 19 business days*

1,163.00€
 
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis,... more
Product information "Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)"
Hormone playing a key role in cardiovascular homeostasis through regulation of natriuresis, diuresis, and vasodilation. Also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Specifically binds and stimulates the cGMP production of the NPR1 receptor. Binds the clearance receptor NPR3. Source: Synthetic human Pro-Atrial Natriuretic Peptide, aa1-30, AA Sequence: NPMYNAVSNADLMDFKNLLDHLEEKMPLED, Storage and Stability: Lyophilized powder may be stored at -20°C. Stable for 12 months after receipt at -20°C. Reconstitute with sterile buffer. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Reconstituted product is stable for 6 months at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: ANP, NPPA
Supplier: United States Biological
Supplier-Nr: 298243

Properties

Conjugate: No
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Pro-Atrial Natriuretic Peptide, Human, aa1-30 (Cardiodilatin-Related Peptide, Pro-ANP)"
Write a review
or to review a product.
Viewed