Penicillin-binding Protein 4, Recombinant, Bacillus Subtilis, aa1-451, His-Tag (PbpE)

Penicillin-binding Protein 4, Recombinant, Bacillus Subtilis, aa1-451, His-Tag (PbpE)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370742.20 20 µg - -

3 - 19 business days*

786.00€
370742.100 100 µg - -

3 - 19 business days*

1,096.00€
370742.1 1 mg - -

3 - 19 business days*

4,029.00€
 
Probably involved in peptidoglycan modification during cortex synthesis.||Source:|Recombinant... more
Product information "Penicillin-binding Protein 4, Recombinant, Bacillus Subtilis, aa1-451, His-Tag (PbpE)"
Probably involved in peptidoglycan modification during cortex synthesis. Source: Recombinant protein corresponding to aa1-451 from Bacillus subtilis PbpE, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~67.4kD, AA Sequence: MKQNKRKHLQTLFETLGEKHQFNGTVLAAEGGDILYHHSFGYAEMTEKRPLKTNSLFELASLSKPFTALGIILLEEKGILGYEDKVDRWLPGFPYQGVTIRHLLNHTSGLPDYMGWFFANWDSHKIAVNQDIVDMLMNEGLSGYFEPNEGWMYSNTGYVLLAVIIEKASGMSYADFIKTSIFLPAGMNETRVYNRRLSPERIDHYAYGYVYDVHSETYVLPDELEETNYVVYLDGIQGDGTVNSVTSDLFRFDQALYQDDFISKASKESAFSPVRLNNGETIDYGFGWVLQNSPEKGRIVSHSGGWPGYSTMMIRYIDHRKTLIYLSNKEEDTEYEQAILKAAEHILFGQPYDVPERPADKKKKAIDTAIYSRYVGSYLLQDGTAAQVTTENERLYLEIAGQLRLELFPSSETRFFLRALSVEVEFTLGEDAAKSFILYEDGSEEEAVRTK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: pbpE, PBP 4A, PBP 4*, BSU34440, Penicillin-binding protein E, Penicillin-binding protein 4*
Supplier: United States Biological
Supplier-Nr: 370742

Properties

Conjugate: No
MW: 67,4
Format: Purified

Database Information

UniProt ID : P32959 | Matching products
Gene ID : GeneID 938615 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Penicillin-binding Protein 4, Recombinant, Bacillus Subtilis, aa1-451, His-Tag (PbpE)"
Write a review
or to review a product.
Viewed