PBOV1 PrEST Antigen

PBOV1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95683.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative... more
Product information "PBOV1 PrEST Antigen"
PrEST Antigen PBOV1, Gene description: prostate and breast cancer overexpressed 1, Alternative Gene Names: UC28, UROC28, Antigen sequence: YSIEQSHHAILTPLQTHLTMKGSSMKCSSLSSEAILFT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 38% Rat gene identity: 38%
Keywords: UC28, PBOV1, UROC28, Protein UROC28, Prostate and breast cancer overexpressed gene 1 protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95683

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : Q9GZY1 | Matching products
Gene ID : GeneID 59351 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "PBOV1 PrEST Antigen"
Write a review
or to review a product.
Viewed