Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| CSB-MP4672XBE.20 | 20 µg | - | - | - |
10 - 14 business days* |
579.00€
|
|
| CSB-MP4672XBE.100 | 100 µg | - | - | - |
10 - 14 business days* |
1,138.00€
|
|
| CSB-MP4672XBE.1 | 1 mg | - | - | - |
10 - 14 business days* |
5,947.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Organism: Xenopus laevis (African clawed frog). Source: Mammalian cell. Expression Region: n/a.... more
Product information "paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis"
Organism: Xenopus laevis (African clawed frog). Source: Mammalian cell. Expression Region: n/a. Protein Length: Heterodimer. Tag Info: C-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions). Target Protein Sequence: MTTAILECIS TLSISFQQLR RLPRFLEGGT TKMPLTVTDS DVPRLFREPY IQTGYRPTDQ DWKYYFLSLF KKHNESVNVW THLLVALAVV LRVVAFVEAG SLSLNVVSFP LYLYVLSSLT YLTCSILAHL LQSKSELAHY TFYFIDYVGV STYQYGCALA HYYYTSNEAW YDKACYFFLP GAAFLGWLSC VGCCYAKYCY KRPYPVMRKI LQVVPAGLAY ILDISPVVHR IVTCHMEDYT DKAVWLHSLQ MIFFIIGAYF FSCPVPEKYF PGSCDFIGHG HQIFHVFLGL CTLSQLEALF IDYQTRQEVF SARYSSNYTL MCCASFFLLI LCSTFTAVYA RRRIKEKLAR KEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK. Purity: The purity information is not available for VLPs proteins. Endotoxin: Not test. Biological Activity: n/a. Form: Lyophilized powder. Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant). Relevance: n/a. Reference: n/a. Function: nan
| Keywords: | Putative membrane progesterone receptor, Progestin and adipoQ receptor family member VIII L homeolog |
| Supplier: | Cusabio |
| Supplier-Nr: | MP4672XBE |
Properties
| Application: | Activity not tested |
| Conjugate: | No |
| Host: | Mammalian cells |
| Species reactivity: | Xenopus laevis (African clawed frog) |
| MW: | 41.9kDa kD |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K25040 | Matching products |
| UniProt ID : | Q801G4 | Matching products |
| Gene ID : | GeneID 378654 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: +4°C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
Viewed