paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis

paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis
Item number Size Datasheet Manual SDS Delivery time Quantity Price
CSB-MP4672XBE.20 20 µg - - -

10 - 14 business days*

579.00€
CSB-MP4672XBE.100 100 µg - - -

10 - 14 business days*

1,138.00€
CSB-MP4672XBE.1 1 mg - - -

10 - 14 business days*

5,947.00€
 
Organism: Xenopus laevis (African clawed frog). Source: Mammalian cell. Expression Region: n/a.... more
Product information "paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis"
Organism: Xenopus laevis (African clawed frog). Source: Mammalian cell. Expression Region: n/a. Protein Length: Heterodimer. Tag Info: C-terminal 6xHis-tagged(This tag can be tested only under denaturing conditions). Target Protein Sequence: MTTAILECIS TLSISFQQLR RLPRFLEGGT TKMPLTVTDS DVPRLFREPY IQTGYRPTDQ DWKYYFLSLF KKHNESVNVW THLLVALAVV LRVVAFVEAG SLSLNVVSFP LYLYVLSSLT YLTCSILAHL LQSKSELAHY TFYFIDYVGV STYQYGCALA HYYYTSNEAW YDKACYFFLP GAAFLGWLSC VGCCYAKYCY KRPYPVMRKI LQVVPAGLAY ILDISPVVHR IVTCHMEDYT DKAVWLHSLQ MIFFIIGAYF FSCPVPEKYF PGSCDFIGHG HQIFHVFLGL CTLSQLEALF IDYQTRQEVF SARYSSNYTL MCCASFFLLI LCSTFTAVYA RRRIKEKLAR KEL&MDAIVETPEMPAVFDGMKLAAVAAFLYIIVRSLNLKNPTAPPDLLYQDTALTRYLIKSCPLLTKEYIPPIIWGKSGHIQTALYGKMGRVSSPHPYGLRKYLTMPDGATATFDLFEPLAEHCTGENVTMVICPGIANHSEKQYIRTFVDYAQKNGYRCAVLNHLGALTNIELTSPRMFTYGCTWEFGAMVNYIRKAFPQTQLIVVGFSLGGNIVCKYLGETASNQERVMCCVSVCQGYSASHAQDTFLQWDQLRRVYNFLMADNMKKIILSHRHILFGDGSKANRVLEDTDLSRLYTATSLMQIDDVVMRKFHGYKTVQEYYEAESCIRYLHNIHVPLMLVNSVDDPLVHDSLLTIPKTLAEKKENVLVVLPLHGGHLGFFEGAVLFPEPLTWMDKLIVQYSNAICQWERNKPQCSDVKQAAESDHK. Purity: The purity information is not available for VLPs proteins. Endotoxin: Not test. Biological Activity: n/a. Form: Lyophilized powder. Buffer: Lyophilized from a 0.2 µm filtered PBS, 6% Trehalose, pH 7.4. Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein indeionized sterile water to a concentration of 0.1-1.0 mg/mL.Aliquot for long-term storage at -80°C. Solubilize for 60 minutes at room temperature with occasional gentle mixing. Avoid vigorous shaking or vortexing. Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: The VLPs are expressed from human 293 cells (HEK293).Mix the sample gently by repeatedly pipetting it up and down. Do not vortex.Repeated freezing and thawing is not recommended.Store the protein at -20°C/-80°C upon receiving it, and ensure to avoid repeated freezing and thawing, otherwise, it will affect the protein activity. The immunization strategy should be optimized (antigen dose, regimen and adjuvant). Relevance: n/a. Reference: n/a. Function: nan
Keywords: Putative membrane progesterone receptor, Progestin and adipoQ receptor family member VIII L homeolog
Supplier: Cusabio
Supplier-Nr: MP4672XBE

Properties

Application: Activity not tested
Conjugate: No
Host: Mammalian cells
Species reactivity: Xenopus laevis (African clawed frog)
MW: 41.9kDa kD
Format: Lyophilized

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: +4°C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "paqr8.L&abhd2.S Heterodimer Protein-VLPs, recombinant Xenopus laevis"
Write a review
or to review a product.
Viewed